Pfam domain
Pfam family: HTH_7 (PF02796.17)
Uniprot AC: P03012
RecName: Transposon gamma-delta resolvase
Begin-End: 141-182
Organism: Escherichia coli
Interaction Mode:   

Sequence:
GRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINES
Structures of the domain P03012 141-182
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1gdt X-ray 3 B 141-182  H-Bb H-Mj L-Bb L-Mj L-Mn 
1gdt X-ray 3 A 141-182  H-Bb H-Mj L-Bb L-Mj L-Mn 
2gm4 X-ray 3.5 B 141-182  H-Bb H-Mj L-Bb L-Mj L-Mn 
2gm4 X-ray 3.5 A 141-182  H-Bb H-Mj L-Bb L-Mj 
1zr4 X-ray 3.4 D 141-182  H-Bb H-Mj L-Bb L-Mj L-Mn 
1zr4 X-ray 3.4 E 141-182  H-Bb H-Mj L-Bb L-Mj L-Mn 
1zr4 X-ray 3.4 B 141-182  H-Bb H-Mj L-Bb L-Mj L-Mn 
1zr4 X-ray 3.4 A 141-182  H-Bb H-Mj L-Bb L-Mj L-Mn 
1zr2 X-ray 3.9 B 141-182  H-Bb H-Mj L-Bb L-Mj L-Mn 
1zr2 X-ray 3.9 A 141-182  H-Bb H-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text