Pfam domain
Pfam family: Resolvase (PF00239.23)
Uniprot AC: P03012
RecName: Transposon gamma-delta resolvase
Begin-End: 3-139
Organism: Escherichia coli
Interaction Mode:   

Sequence:
LFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVEEGDVIL
VKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDGEMGKMVVTILSAVAQAERQRI
LERTNEGRQEAMAKGVV
Structures of the domain P03012 3-139
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1gdt X-ray 3 B 3-139  H-Bb L-Bb 
1gdt X-ray 3 A 3-139  H-Mn 
2gm4 X-ray 3.5 B 3-139 None
2gm4 X-ray 3.5 A 3-139 None
1zr4 X-ray 3.4 D 3-139 None
1zr4 X-ray 3.4 B 3-139 None
1zr4 X-ray 3.4 A 3-139 None
1zr4 X-ray 3.4 E 3-139 None
1zr2 X-ray 3.9 B 3-139 None
1zr2 X-ray 3.9 A 3-139 None


© NPIDB team 2003 - 2021

text