Pfam domain
Pfam family: HTH_7 (PF02796.17)
Uniprot AC: P03013
RecName: DNA-invertase hin
Begin-End: 139-183
Organism: Salmonella typhimurium
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPAS
Structures of the domain P03013 139-183
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1jkq X-ray 2.86 C 140-183  H-Bb H-Mj L-Bb L-Mn 
1hcr X-ray 2.3 A 139-183  H-Bb H-Mj L-Bb L-Mn 
1jkp X-ray 2.8 C 139-183  H-Bb H-Mj L-Bb L-Mn 
1jkr X-ray 2.28 C 139-183  H-Bb H-Mj L-Bb L-Mn 
1jj6 X-ray 2.3 C 139-183  H-Bb H-Mj L-Bb L-Mn 
1ijw X-ray 2.4 C 139-183  H-Bb H-Mj L-Bb L-Mn 
1jko X-ray 2.24 C 139-183  H-Bb H-Mj L-Bb L-Mn 
1jj8 X-ray 2.75 C 139-183  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2021

text