Pfam domain
Pfam family: Peripla_BP_3 (PF13377.5)
Uniprot AC: P03023
RecName: Lactose operon repressor
Begin-End: 171-329
Organism: Escherichia coli
Interaction Mode:   

Sequence:
VEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTM
QMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIK
QDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTT
Structures of the domain P03023 171-329
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2pe5 X-ray 3.5 A 171-329 None
2pe5 X-ray 3.5 B 171-329 None
2pe5 X-ray 3.5 B 171-329 None
2pe5 X-ray 3.5 C 171-329 None
1lbg X-ray 4.8 C 171-329 None
1lbg X-ray 4.8 D 171-329 None
1lbg X-ray 4.8 B 171-329 None
1lbg X-ray 4.8 A 171-329 None
1jwl X-ray 4 C 171-329 None
1jwl X-ray 4 A 171-329 None
1jwl X-ray 4 A 231-329 None
1jwl X-ray 4 B 171-329 None
1efa X-ray 2.6 C 171-329 None
1efa X-ray 2.6 A 171-329 None
1efa X-ray 2.6 B 171-329 None


© NPIDB team 2003 - 2019

text