Pfam domain
Pfam family: LacI (PF00356.20)
Uniprot AC: P03023
RecName: Lactose operon repressor
Begin-End: 5-50
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
TLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPN
Structures of the domain P03023 5-50
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1osl NMR B 5-50  H-Bb H-Mj 
1osl NMR A 5-50  H-Bb H-Mj L-Bb L-Mj 
2kej NMR B 5-50  H-Bb H-Mj L-Bb L-Mj 
2kej NMR A 5-50  H-Bb H-Mj L-Bb L-Mj 
2pe5 X-ray 3.5 A 5-50  H-Bb H-Mj L-Bb L-Mj 
2pe5 X-ray 3.5 B 5-50  H-Bb H-Mj L-Bb L-Mj 
2pe5 X-ray 3.5 B 5-50 None
2pe5 X-ray 3.5 C 5-50 None
1lbg X-ray 4.8 C 5-50 None
1lbg X-ray 4.8 D 5-50 None
1lbg X-ray 4.8 B 5-50 None
1lbg X-ray 4.8 A 5-50 None
1l1m NMR B 5-50  H-Bb H-Mj L-Bb L-Mj 
1l1m NMR A 5-50  H-Bb H-Mj L-Bb L-Mj 
1lcc NMR A 5-50  H-Bb H-Mj L-Bb L-Mj 
2kei NMR B 5-50  H-Bb H-Mj L-Bb L-Mj 
2kei NMR A 5-50  H-Bb H-Mj L-Bb L-Mj 
2kek NMR B 5-50  H-Bb L-Bb L-Mj 
2kek NMR A 5-50  H-Bb H-Mj L-Bb L-Mj 
1cjg NMR B 5-50  H-Bb H-Mj L-Bb L-Mj 
1cjg NMR A 5-50  H-Bb H-Mj L-Bb L-Mj 
2bjc NMR B 105-150  H-Bb H-Mj L-Bb L-Mj 
2bjc NMR A 5-50  H-Bb H-Mj L-Bb L-Mj 
1lcd NMR A 5-50  H-Bb H-Mj L-Bb L-Mj 
1jwl X-ray 4 A 65-110 None
1jwl X-ray 4 B 5-50 None
1efa X-ray 2.6 A 5-50 None
1efa X-ray 2.6 B 5-50 None


© NPIDB team 2003 - 2019

text