Pfam domain
Pfam family: Peptidase_S24 (PF00717.25)
Uniprot AC: P03034
RecName: Repressor protein cI
Begin-End: 105-227
Organism: Escherichia phage lambda
Interaction Mode:   

Sequence:
PVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDSAFWLEVEGNSMTAPTGSKPSFPDG
MLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSVVG
KVI
Structures of the domain P03034 105-227
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3bdn X-ray 3.91 B 104-226 None
3bdn X-ray 3.91 A 104-226 None


© NPIDB team 2003 - 2021

text