Pfam domain
Pfam family: HTH_3 (PF01381.21)
Uniprot AC: P03036
RecName: Regulatory protein cro
Begin-End: 8-61
Organism: Enterobacteria phage 434
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
LKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPRFLFEIAMALNCDPVWL
Structures of the domain P03036 8-61
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3cro X-ray 2.5 R 6-59  H-Bb H-Mj L-Bb L-Mj 
3cro X-ray 2.5 L 6-59  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2020

text