Pfam domain
Pfam family: Cro (PF09048.9)
Uniprot AC: P03040
RecName: Regulatory protein cro
Begin-End: 2-60
Organism: Escherichia phage lambda
Interaction Mode:   

Sequence:
EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPS
Structures of the domain P03040 2-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4cro X-ray 3.9 A 4-60 None
4cro X-ray 3.9 B 4-60 None
4cro X-ray 3.9 D 4-60 None
4cro X-ray 3.9 C 4-60 None
4cro X-ray 3.9 F 4-60 None
4cro X-ray 3.9 E 4-60 None
6cro X-ray 3 A 3-60 None
3orc X-ray 3 A 3-65 None


© NPIDB team 2003 - 2019

text