Pfam domain
Pfam family: Phage_CII (PF05269.10)
Uniprot AC: P03042
RecName: Transcriptional activator II
Begin-End: 7-79
Organism: Escherichia phage lambda
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
RNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKRDWIPKFSMLLAVLEWGVVDDD
MARLARQVAAILT
Structures of the domain P03042 7-79
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1zs4 X-ray 1.7 D 7-79  H-Bb 
1zs4 X-ray 1.7 A 3-81  H-Bb H-Mj L-Bb L-Mj 
1zs4 X-ray 1.7 C 4-82  H-Bb H-Mj L-Bb L-Mj 
1zs4 X-ray 1.7 B 3-81  H-Bb 


© NPIDB team 2003 - 2019

text