Pfam domain
Pfam family: Arc (PF03869.13)
Uniprot AC: P03050
RecName: Transcriptional repressor arc
Begin-End: 4-52
Organism: Salmonella phage P22
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
MSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIG
Structures of the domain P03050 4-52
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1par X-ray 2.6 D 4-53  H-Bb H-Mj S-Bb S-Mj 
1par X-ray 2.6 A 4-52  H-Bb S-Mj L-Bb L-Mj 
1par X-ray 2.6 B 4-53  H-Bb H-Mj S-Bb S-Mj 
1par X-ray 2.6 C 4-50  H-Bb H-Mj S-Bb S-Mj 
1bdv X-ray 2.8 D 4-50  H-Bb H-Mj S-Mj 
1bdv X-ray 2.8 C 7-49  H-Bb S-Mj 
1bdv X-ray 2.8 A 7-52  H-Bb S-Mj 
1bdv X-ray 2.8 B 4-53  H-Bb H-Mj S-Bb S-Mj 
1bdt X-ray 2.5 A 4-52  H-Bb S-Bb S-Mj L-Bb L-Mj 
1bdt X-ray 2.5 D 4-50  H-Bb H-Mj S-Bb S-Mj 
1bdt X-ray 2.5 C 4-50  H-Bb H-Mj S-Bb S-Mj 
1bdt X-ray 2.5 B 4-53  H-Bb H-Mj S-Bb S-Mj 


© NPIDB team 2003 - 2019

text