Pfam domain
Pfam family: KORA (PF16509.7)
Uniprot AC: P03052
RecName: TrfB transcriptional repressor protein
Begin-End: 5-88
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
LTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAVSQAVHRVWAAFED
KNLPEGYARVTAVLPEHQAYIVRK
Structures of the domain P03052 5-88
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5clv X-ray 2.5 A 5-88  H-Bb H-Mj L-Bb L-Mj 
5clv X-ray 2.5 B 5-88  H-Bb H-Mj L-Bb L-Mj 
5cm3 X-ray 2.3 A 5-88  H-Bb H-Mj L-Bb 
5cm3 X-ray 2.3 B 5-88  H-Bb H-Mj L-Bb 
2w7n X-ray 1.85 B 5-88  H-Bb H-Mj L-Bb L-Mj 
2w7n X-ray 1.85 A 5-88  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text