Pfam domain
Pfam family: Rep_3 (PF01051.20)
Uniprot AC: P03067
RecName: PI protein
Begin-End: 11-263
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
KKTKIRHRNELNHTLAQLPLPAKRVMYMALAPIDSKEPLERGRVFKIRAEDLAALAKITP
SLAYRQLKEGGKLLGASKISLRGDDIIALAKELNLPFTAKNSPEELDLNIIEWIAYSPDE
GYLSLKFTRTIEPYISSLIGKKNKFTTQLLTASLRLSSQYSSSLYQLIRKHYSNFKKKNY
FIISVDELKEELIAYTFDKDGNIEYKYPDFPIFKRDVLNKAIAEIKKKTEISFVGFTVHE
KEGRKISKLKFEF
Structures of the domain P03067 11-263
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2nra X-ray 3.1 C 11-263  H-Bb H-Mj S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2020

text