Pfam domain
Pfam family: PPV_E1_C (PF00519.16)
Uniprot AC: P03116
RecName: Replication protein E1
Begin-End: 166-303
Organism: Bovine papillomavirus type 1
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
LFKSLFLCSFHDITRLFKNDKTTNQQWVLAVFGLAEVFFEASFELLKKQCSFLQMQKRSH
EGGTCAVYLICFNTAKSRETVRNLMANTLNVREECLMLQPAKIRGLSAALFWFKSSLSPA
TLKHGALPEWIRAQTTLN
Structures of the domain P03116 166-303
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ksy X-ray 3.05 A 167-302  H-Bb S-Bb S-Mj L-Bb L-Mj 
1ksy X-ray 3.05 C 167-302  H-Bb S-Bb S-Mj L-Bb L-Mj 
1ksy X-ray 3.05 C 170-302  H-Bb S-Bb S-Mj L-Bb L-Mj 
1ksy X-ray 3.05 B 167-302  H-Bb S-Bb S-Mj L-Bb L-Mj 
1ksx X-ray 3.2 N 167-302  S-Bb S-Mj L-Bb L-Mj 
1ksx X-ray 3.2 M 167-302  H-Bb S-Bb S-Mj L-Bb L-Mj 
1ksx X-ray 3.2 J 167-302  S-Bb S-Mj L-Bb L-Mj 
1ksx X-ray 3.2 I 167-302  H-Bb S-Bb S-Mj L-Bb L-Mj 
1ksx X-ray 3.2 F 167-302 None
1ksx X-ray 3.2 E 167-302 None
1ksx X-ray 3.2 B 167-302 None
1ksx X-ray 3.2 A 167-302 None


© NPIDB team 2003 - 2019

text