Pfam domain
Pfam family: PPV_E2_C (PF00511.16)
Uniprot AC: P03122
RecName: Regulatory protein E2
Begin-End: 328-405
Organism: Bovine papillomavirus type 1
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
FALISGTANQVKCYRFRVKKNHRHRYENCTTTWFTVADNGAERQGQAQILITFGSPSQRQ
DFLKHVPLPPGMNISGFT
Structures of the domain P03122 328-405
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2bop X-ray 1.7 A 330-402  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text