Pfam domain
Pfam family: Integrase_Zn (PF02022.21)
Uniprot AC: P03354
RecName: Gag-Pol polyprotein
Begin-End: 1285-1320
Organism: Rous sarcoma virus
Interaction Mode:   

Sequence:
AKDLHTALHIGPRALSKACNISMQQAREVVQTCPHC
Structures of the domain P03354 1285-1320
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ejk X-ray 3.8 F 5-56 None
5ejk X-ray 3.8 G 5-53 None
5ejk X-ray 3.8 H 5-42 None
5ejk X-ray 3.8 E 5-42 None
5ejk X-ray 3.8 D 5-53 None
5ejk X-ray 3.8 C 5-54 None
5ejk X-ray 3.8 B 5-58 None
5ejk X-ray 3.8 A 5-42  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text