Pfam domain
Pfam family: rve (PF00665.25)
Uniprot AC: P03354
RecName: Gag-Pol polyprotein
Begin-End: 1335-1425
Organism: Rous sarcoma virus
Interaction Mode:   

Sequence:
LGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAVQHHWATAIAVLGR
PKAIKTDNGSCFTSKSTREWLARWGIAHTTG
Structures of the domain P03354 1335-1425
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ejk X-ray 3.8 G 57-164 None


© NPIDB team 2003 - 2021

text