Pfam domain
Pfam family: rve (PF00665.25)
Uniprot AC: P03354
RecName: Gag-Pol polyprotein
Begin-End: 1335-1430
Organism: Rous sarcoma virus
Interaction Mode:   

Sequence:
LGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAVQHHWATAIAVLGR
PKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNS
Structures of the domain P03354 1335-1430
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ejk X-ray 3.8 H 57-164 None
5ejk X-ray 3.8 F 56-164 None
5ejk X-ray 3.8 E 57-164  H-Bb H-Mn S-Bb L-Bb L-Mn 
5ejk X-ray 3.8 D 57-164 None
5ejk X-ray 3.8 C 57-164 None
5ejk X-ray 3.8 B 39-164 None
5ejk X-ray 3.8 A 57-164  H-Bb H-Mn S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text