Pfam domain
Pfam family: RVT_1 (PF00078.26)
Uniprot AC: P03355
RecName: Gag-Pol polyprotein
Begin-End: 760-932
Organism: Moloney murine leukemia virus (isolate Shinnick)
Interaction Mode:  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mn 

Sequence:
VKKPGTNDYRPVQDLREVNKRVEDIHPTVPNPYNLLSGLPPSHQWYTVLDLKDAFFCLRL
HPTSQPLFAFEWRDPEMGISGQLTWTRLPQGFKNSPTLFDEALHRDLADFRIQHPDLILL
QYVDDLLLAATSELDCQQGTRALLQTLGNLGYRASAKKAQICQKQVKYLGYLL
Structures of the domain P03355 760-932
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4xpc X-ray 1.68 A 102-271 None
1qaj X-ray 2.3 B 101-271 None
1qaj X-ray 2.3 A 101-271 None
2r2r X-ray 2.1 A 101-271 None
2fvs X-ray 2.35 A 101-271  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mn 
1d0e X-ray 3 A 101-271 None
1d0e X-ray 3 B 101-271 None
1ztw X-ray 1.8 A 101-271 None
2fvr X-ray 2.2 A 101-271  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mn 
2fvq X-ray 2.3 A 101-271  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mn 
2fvp X-ray 2.25 A 101-271  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mn 
1d1u X-ray 2.3 A 101-271 None
1ztt X-ray 1.85 A 101-271 None
1qai X-ray 2.3 B 101-271 None
1qai X-ray 2.3 A 101-271 None
1i6j X-ray 2 A 101-271 None
5vbs X-ray 1.75 A 102-271 None
2fjx X-ray 1.8 A 101-271 None
1n4l X-ray 2 A 101-271 None
2r2t X-ray 2 A 101-271 None
2fjv X-ray 2.05 A 101-271 None
2r2u X-ray 2.3 A 101-271 None
4xpe X-ray 1.78 A 102-271 None
4m94 X-ray 2.14 A 106-271 None
2r2s X-ray 2.8 A 101-271 None
3fsi X-ray 1.75 A 109-271 None
4xo0 X-ray 1.7 A 109-271 None
2fjw X-ray 1.95 A 101-271 None
4m95 X-ray 1.72 A 106-271 None


© NPIDB team 2003 - 2019

text