Pfam domain
Pfam family: rve (PF00665.25)
Uniprot AC: P03365
RecName: Gag-Pro-Pol polyprotein
Begin-End: 1492-1604
Organism: Mouse mammary tumor virus
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb 

Sequence:
LKPRVLWQMDVTHVSEFGKLKYVHVTVDTYSHFTFATARTGEATKDVLQHLAQSFAYMGI
PQKIKTDNAPAYVSRSIQEFLARWKISHVTGIPYNPQGQAIVERTHQNIKAQL
Structures of the domain P03365 1492-1604
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jca X-ray 4.8 F 57-167 None
3jca X-ray 4.8 E 57-167  H-Bb H-Mj H-Mn L-Bb 
3jca X-ray 4.8 B 57-167 None
3jca X-ray 4.8 A 57-167  H-Bb H-Mn L-Bb 


© NPIDB team 2003 - 2019

text