Pfam domain
Pfam family: RNase_H (PF00075.23)
Uniprot AC: P03366
RecName: Gag-Pol polyprotein
Begin-End: 1035-1153
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate BH10)
Interaction Mode:  H-Bb H-Mn L-Bb L-Mn 

Sequence:
GAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNI
VTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Structures of the domain P03366 1035-1153
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1n5y X-ray 3.1 A 438-556  H-Bb H-Mn 
1rtd X-ray 3.2 A 438-553  H-Bb L-Bb L-Mn 
1rtd X-ray 3.2 C 438-553  H-Bb H-Mn L-Bb L-Mn 
5hp1 X-ray 2.9 A 438-552  H-Bb L-Bb 
5hp1 X-ray 2.9 C 438-552  H-Bb L-Bb 
5d3g X-ray 2.3 A 438-552  H-Bb L-Bb 
5d3g X-ray 2.3 C 438-552  H-Bb L-Bb 
1t05 X-ray 3 A 438-553  H-Bb 
5txp X-ray 2.7 A 438-553  H-Bb L-Bb L-Mn 
5txp X-ray 2.7 C 438-553  H-Bb L-Bb 
1r0a X-ray 2.8 A 438-556  H-Bb L-Bb L-Mn 
3klf X-ray 3.15 M 438-553  H-Bb L-Bb 
3klf X-ray 3.15 A 438-553 None
3klf X-ray 3.15 I 438-553 None
3klf X-ray 3.15 E 438-553 None
1t03 X-ray 3.1 A 438-556  H-Bb L-Bb L-Mn 
1hvu X-ray 4.75 J 438-553 None
1hvu X-ray 4.75 A 438-553 None
1hvu X-ray 4.75 D 438-553 None
1hvu X-ray 4.75 G 438-553 None
3jyt X-ray 3.3 A 438-553  H-Bb L-Mn 
1n6q X-ray 3 A 438-556  H-Bb 
3klg X-ray 3.65 E 438-553  H-Bb L-Bb 
3klg X-ray 3.65 A 438-553 None
3kle X-ray 3.2 M 438-556  H-Bb L-Bb L-Mn 
3kle X-ray 3.2 I 438-556 None
3kle X-ray 3.2 E 438-556 None
3kle X-ray 3.2 A 438-556 None
5txl X-ray 2.5 A 438-553  H-Bb L-Bb 
5txl X-ray 2.5 C 438-553  H-Bb L-Bb 
3jsm X-ray 3 A 438-553  H-Bb L-Bb L-Mn 
1hys X-ray 3 A 438-552 None
1j5o X-ray 3.5 A 438-556  H-Bb L-Bb 
2hmi X-ray 2.8 A 438-556  L-Bb 
5i3u X-ray 3 A 438-552  H-Bb L-Bb 
5i3u X-ray 3 C 438-552  H-Bb L-Bb 
3klh X-ray 2.9 A 438-556  H-Bb L-Bb 
4puo X-ray 2.9 A 438-553 None
4puo X-ray 2.9 C 438-553 None
4q0b X-ray 3.3 A 438-553 None
4q0b X-ray 3.3 C 438-553 None
4pwd X-ray 3 A 438-553 None
4pwd X-ray 3 C 438-553 None
3v81 X-ray 2.85 A 438-553  H-Bb L-Bb L-Mn 
3v81 X-ray 2.85 C 438-553 None
6b19 X-ray 4.5 A 438-553 None
4r5p X-ray 2.89 C 438-553  H-Bb L-Bb L-Mn 
4r5p X-ray 2.89 A 438-553 None
5hlf X-ray 2.95 A 438-553  H-Bb L-Bb 
5hlf X-ray 2.95 C 438-552  H-Bb L-Bb 
5txn X-ray 2.55 A 438-553  H-Bb L-Bb L-Mn 
5txn X-ray 2.55 C 438-553  H-Bb L-Bb 
3v4i X-ray 2.8 C 438-553  H-Bb L-Bb 
3v4i X-ray 2.8 A 438-553 None
5txm X-ray 2.7 A 438-553  H-Bb L-Bb 
5txm X-ray 2.7 C 438-553  H-Bb L-Bb 
5hro X-ray 2.75 A 438-553  H-Bb L-Bb 
5hro X-ray 2.75 C 438-553  H-Bb L-Bb 
5txo X-ray 2.55 A 438-553  H-Bb L-Bb 
5txo X-ray 2.55 C 438-553  H-Bb L-Bb L-Mn 
3v6d X-ray 2.7 A 438-553  H-Bb L-Bb 
3v6d X-ray 2.7 C 438-553  H-Bb L-Bb 
5i42 X-ray 3.3 A 438-553  H-Bb L-Bb 
5i42 X-ray 3.3 C 438-553  H-Bb L-Bb 


© NPIDB team 2003 - 2019

text