Pfam domain
Pfam family: RVT_thumb (PF06817.16)
Uniprot AC: P03366
RecName: Gag-Pol polyprotein
Begin-End: 840-903
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate BH10)
Interaction Mode:  H-Bb L-Bb 

Sequence:
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELA
Structures of the domain P03366 840-903
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1rtd X-ray 3.2 C 241-304  H-Bb L-Bb 
1rtd X-ray 3.2 A 241-304  H-Bb L-Bb 
6asw X-ray 2.61 B 241-304 None
6asw X-ray 2.61 A 241-304  H-Bb L-Bb 
6asw X-ray 2.61 D 241-304 None
6asw X-ray 2.61 C 241-304  H-Bb L-Bb 
5txo X-ray 2.55 B 241-304 None
5txo X-ray 2.55 A 241-304  H-Bb L-Bb 
5txo X-ray 2.55 D 241-304 None
5txo X-ray 2.55 C 241-304  H-Bb L-Bb 
2hmi X-ray 2.8 B 241-304 None
2hmi X-ray 2.8 A 241-304  H-Bb L-Bb 
3klh X-ray 2.9 A 241-304  H-Bb L-Bb 
3klh X-ray 2.9 B 241-304 None
1t05 X-ray 3 A 241-304  H-Bb L-Bb 
6an8 X-ray 2.6 B 241-304 None
6an8 X-ray 2.6 A 241-304  H-Bb L-Bb 
6an8 X-ray 2.6 C 241-304  H-Bb L-Bb 
6an8 X-ray 2.6 D 241-304 None
3klf X-ray 3.15 N 241-304 None
3klf X-ray 3.15 M 241-304  H-Bb L-Bb 
3klf X-ray 3.15 B 241-304 None
3klf X-ray 3.15 A 241-304  H-Bb L-Bb 
3klf X-ray 3.15 F 241-304 None
3klf X-ray 3.15 E 241-304  H-Bb L-Bb 
3klf X-ray 3.15 J 241-304 None
3klf X-ray 3.15 I 241-304  H-Bb L-Bb 
4r5p X-ray 2.89 B 241-304 None
4r5p X-ray 2.89 A 241-304  H-Bb L-Bb 
4r5p X-ray 2.89 C 241-304  H-Bb L-Bb 
4r5p X-ray 2.89 D 241-304 None
1hvu X-ray 4.75 K 241-304 None
1hvu X-ray 4.75 J 241-304 None
1hvu X-ray 4.75 G 241-304 None
1hvu X-ray 4.75 H 241-304 None
1hvu X-ray 4.75 E 241-304 None
1hvu X-ray 4.75 D 241-304 None
1hvu X-ray 4.75 B 241-304 None
1hvu X-ray 4.75 A 241-304 None
3jyt X-ray 3.3 B 241-304 None
3jyt X-ray 3.3 A 241-304  H-Bb L-Bb 
3klg X-ray 3.65 F 241-304 None
3klg X-ray 3.65 E 241-304  H-Bb L-Bb 
3klg X-ray 3.65 B 241-304 None
3klg X-ray 3.65 A 241-304  H-Bb L-Bb 
1t03 X-ray 3.1 B 241-304 None
1t03 X-ray 3.1 A 241-304  H-Bb L-Bb 
5txl X-ray 2.5 D 241-304 None
5txl X-ray 2.5 C 241-304  H-Bb L-Bb 
5txl X-ray 2.5 B 241-304 None
5txl X-ray 2.5 A 241-304  H-Bb L-Bb 
6o9e X-ray 2.4 D 241-304 None
6o9e X-ray 2.4 C 241-304  H-Bb L-Bb 
6o9e X-ray 2.4 B 241-304 None
6o9e X-ray 2.4 A 241-304  H-Bb L-Bb 
6hak X-ray 3.95 D 241-304 None
6hak X-ray 3.95 C 241-304 None
6hak X-ray 3.95 B 241-304 None
6hak X-ray 3.95 A 241-304 None
6an2 X-ray 2.7 B 241-304 None
6an2 X-ray 2.7 A 241-304  H-Bb L-Bb 
6an2 X-ray 2.7 D 241-304 None
6an2 X-ray 2.7 C 241-304  H-Bb L-Bb 
3jsm X-ray 3 B 241-304 None
3jsm X-ray 3 A 241-304  H-Bb L-Bb 
5txm X-ray 2.7 B 241-304 None
5txm X-ray 2.7 A 241-304  H-Bb L-Bb 
5txm X-ray 2.7 C 241-304  H-Bb L-Bb 
5txm X-ray 2.7 D 241-304 None
5hro X-ray 2.75 B 241-304 None
5hro X-ray 2.75 A 241-304  H-Bb L-Bb 
5hro X-ray 2.75 D 241-304 None
5hro X-ray 2.75 C 241-304  H-Bb L-Bb 
6oun X-ray 2.66 B 241-304 None
6oun X-ray 2.66 A 241-304  H-Bb L-Bb 
5i42 X-ray 3.3 B 241-304 None
5i42 X-ray 3.3 A 241-304  H-Bb 
5i42 X-ray 3.3 D 241-304 None
5i42 X-ray 3.3 C 241-304  L-Bb 
5txn X-ray 2.55 B 241-304 None
5txn X-ray 2.55 A 241-304  H-Bb L-Bb 
5txn X-ray 2.55 D 241-304 None
5txn X-ray 2.55 C 241-304  H-Bb L-Bb 
4puo X-ray 2.9 B 241-304 None
4puo X-ray 2.9 A 241-304 None
4puo X-ray 2.9 D 241-304 None
4puo X-ray 2.9 C 241-304 None
4q0b X-ray 3.3 A 241-304 None
4q0b X-ray 3.3 B 241-304 None
4q0b X-ray 3.3 D 241-304 None
4q0b X-ray 3.3 C 241-304 None
4pqu X-ray 2.51 A 241-304 None
4pqu X-ray 2.51 B 241-304 None
4pqu X-ray 2.51 D 241-304 None
4pqu X-ray 2.51 C 241-304 None
5i3u X-ray 3 D 241-304 None
5i3u X-ray 3 C 241-304  H-Bb L-Bb 
5i3u X-ray 3 B 241-304 None
5i3u X-ray 3 A 241-304  H-Bb L-Bb 
4pwd X-ray 3 B 241-304 None
4pwd X-ray 3 A 241-304 None
4pwd X-ray 3 D 241-304 None
4pwd X-ray 3 C 241-304 None
3v81 X-ray 2.85 C 241-304  H-Bb L-Bb 
3v81 X-ray 2.85 D 241-304 None
3v81 X-ray 2.85 B 241-304 None
3v81 X-ray 2.85 A 241-304  H-Bb L-Bb 
5hlf X-ray 2.95 B 241-304 None
5hlf X-ray 2.95 A 241-304  H-Bb L-Bb 
5hlf X-ray 2.95 D 241-304 None
5hlf X-ray 2.95 C 241-304  L-Bb 
6waz X-ray 4.1 A 241-304 None
5txp X-ray 2.7 D 241-304 None
5txp X-ray 2.7 C 241-304  H-Bb L-Bb 
5txp X-ray 2.7 B 241-304 None
5txp X-ray 2.7 A 241-304  H-Bb L-Bb 
3v4i X-ray 2.8 D 241-304 None
3v4i X-ray 2.8 C 241-304  H-Bb L-Bb 
3v4i X-ray 2.8 B 241-304 None
3v4i X-ray 2.8 A 241-304  H-Bb L-Bb 
5hp1 X-ray 2.9 D 241-304 None
5hp1 X-ray 2.9 C 241-304  H-Bb L-Bb 
5hp1 X-ray 2.9 B 241-304 None
5hp1 X-ray 2.9 A 241-304  H-Bb L-Bb 
6amo X-ray 2.5 D 241-304 None
6amo X-ray 2.5 C 241-304  H-Bb L-Bb 
6amo X-ray 2.5 B 241-304 None
6amo X-ray 2.5 A 241-304  H-Bb L-Bb 
3kle X-ray 3.2 B 241-304 None
3kle X-ray 3.2 A 241-304  H-Bb L-Bb 
3kle X-ray 3.2 F 241-304 None
3kle X-ray 3.2 E 241-304  H-Bb L-Bb 
3kle X-ray 3.2 J 241-304 None
3kle X-ray 3.2 I 241-304  H-Bb L-Bb 
3kle X-ray 3.2 N 241-304 None
3kle X-ray 3.2 M 241-304  H-Bb L-Bb 
6avm X-ray 2.5 D 241-304 None
6avm X-ray 2.5 C 241-304  H-Bb L-Bb 
6avm X-ray 2.5 B 241-304 None
6avm X-ray 2.5 A 241-304  H-Bb L-Bb 
3v6d X-ray 2.7 D 241-304 None
3v6d X-ray 2.7 C 241-304  H-Bb L-Bb 
3v6d X-ray 2.7 B 241-304 None
3v6d X-ray 2.7 A 241-304  H-Bb 
1r0a X-ray 2.8 B 241-304 None
1r0a X-ray 2.8 A 241-304  H-Bb L-Bb 
1hys X-ray 3 B 241-304 None
1hys X-ray 3 A 241-304 None
1j5o X-ray 3.5 B 241-304 None
1j5o X-ray 3.5 A 241-304  H-Bb L-Bb 
1n5y X-ray 3.1 B 241-304 None
1n5y X-ray 3.1 A 241-304  H-Bb L-Bb 
1n6q X-ray 3 A 241-304  H-Bb L-Bb 
1n6q X-ray 3 B 241-304 None
5d3g X-ray 2.3 B 241-304 None
5d3g X-ray 2.3 A 241-304  H-Bb L-Bb 
5d3g X-ray 2.3 D 241-304 None
5d3g X-ray 2.3 C 241-304  H-Bb L-Bb 
6bhj X-ray 2.81 A 241-304 None
6bhj X-ray 2.81 B 241-304 None
6bhj X-ray 2.81 D 241-304 None
6bhj X-ray 2.81 C 241-304 None
6b19 X-ray 4.5 B 241-304 None
6b19 X-ray 4.5 A 241-304 None
6wb1 X-ray 4.7 A 241-304 None
6anq X-ray 2.59 B 241-304 None
6anq X-ray 2.59 A 241-304  H-Bb L-Bb 
6anq X-ray 2.59 D 241-304 None
6anq X-ray 2.59 C 241-304  H-Bb L-Bb 
6avt X-ray 2.6 C 241-304  H-Bb L-Bb 
6avt X-ray 2.6 D 241-304 None
6avt X-ray 2.6 A 241-304  H-Bb L-Bb 
6avt X-ray 2.6 B 241-304 None


© NPIDB team 2003 - 2021

text