Pfam domain
Pfam family: RVT_connect (PF06815.12)
Uniprot AC: P03366
RecName: Gag-Pol polyprotein
Begin-End: 917-1018
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate BH10)
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
YYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITT
ESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNT
Structures of the domain P03366 917-1018
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1n5y X-ray 3.1 B 318-419 None
1n5y X-ray 3.1 A 318-419  S-Bb L-Bb 
1rtd X-ray 3.2 A 318-419  H-Bb S-Bb L-Bb 
1rtd X-ray 3.2 C 318-419  H-Bb S-Bb 
5hp1 X-ray 2.9 B 318-419  L-Bb 
5hp1 X-ray 2.9 A 318-419  S-Bb L-Bb 
5hp1 X-ray 2.9 C 318-419  S-Bb L-Bb 
5hp1 X-ray 2.9 D 318-419  H-Bb L-Bb 
5d3g X-ray 2.3 A 318-419  S-Bb L-Bb 
5d3g X-ray 2.3 B 318-419 None
5d3g X-ray 2.3 C 318-419  S-Bb 
5d3g X-ray 2.3 D 318-419 None
1t05 X-ray 3 A 318-419 None
5txp X-ray 2.7 A 318-419  S-Bb L-Bb 
5txp X-ray 2.7 B 318-419 None
5txp X-ray 2.7 C 318-419  S-Bb L-Bb 
5txp X-ray 2.7 D 318-419 None
1r0a X-ray 2.8 A 318-419  S-Bb L-Bb 
1r0a X-ray 2.8 B 318-419 None
3klf X-ray 3.15 M 318-419  S-Bb L-Bb 
3klf X-ray 3.15 N 318-419  H-Bb 
3klf X-ray 3.15 B 318-419 None
3klf X-ray 3.15 A 318-419 None
3klf X-ray 3.15 J 318-419 None
3klf X-ray 3.15 I 318-419 None
3klf X-ray 3.15 E 318-419 None
3klf X-ray 3.15 F 318-419 None
1t03 X-ray 3.1 B 318-419 None
1t03 X-ray 3.1 A 318-419  S-Bb L-Bb 
1hvu X-ray 4.75 K 318-419 None
1hvu X-ray 4.75 J 318-419 None
1hvu X-ray 4.75 A 318-419 None
1hvu X-ray 4.75 B 318-419 None
1hvu X-ray 4.75 E 318-419 None
1hvu X-ray 4.75 D 318-419 None
1hvu X-ray 4.75 H 318-419 None
1hvu X-ray 4.75 G 318-419 None
3jyt X-ray 3.3 B 318-419  H-Bb 
3jyt X-ray 3.3 A 318-419  S-Bb 
1n6q X-ray 3 B 318-419  H-Bb 
1n6q X-ray 3 A 318-419  S-Bb L-Bb 
3klg X-ray 3.65 F 318-419  H-Bb 
3klg X-ray 3.65 E 318-419  S-Bb L-Bb 
3klg X-ray 3.65 B 318-419 None
3klg X-ray 3.65 A 318-419 None
3kle X-ray 3.2 M 318-419  S-Bb 
3kle X-ray 3.2 N 318-419 None
3kle X-ray 3.2 J 318-419 None
3kle X-ray 3.2 I 318-419 None
3kle X-ray 3.2 E 318-419 None
3kle X-ray 3.2 F 318-419 None
3kle X-ray 3.2 B 318-419 None
3kle X-ray 3.2 A 318-419 None
5txl X-ray 2.5 A 318-419  S-Bb L-Bb 
5txl X-ray 2.5 B 318-419 None
5txl X-ray 2.5 D 318-419 None
5txl X-ray 2.5 C 318-419  S-Bb L-Bb 
3jsm X-ray 3 B 318-419  H-Bb 
3jsm X-ray 3 A 318-419 None
1hys X-ray 3 A 318-419 None
1hys X-ray 3 B 318-419 None
1j5o X-ray 3.5 B 318-419 None
1j5o X-ray 3.5 A 318-419  S-Bb L-Bb 
2hmi X-ray 2.8 B 318-419 None
2hmi X-ray 2.8 A 318-419  S-Bb 
5i3u X-ray 3 A 318-419  S-Bb L-Bb 
5i3u X-ray 3 B 318-419  L-Bb 
5i3u X-ray 3 D 318-419 None
5i3u X-ray 3 C 318-419  S-Bb L-Bb 
3klh X-ray 2.9 B 318-419 None
3klh X-ray 2.9 A 318-419  S-Bb L-Bb 
4puo X-ray 2.9 B 318-419 None
4puo X-ray 2.9 A 318-419 None
4puo X-ray 2.9 C 318-419 None
4puo X-ray 2.9 D 318-419 None
4q0b X-ray 3.3 B 318-419 None
4q0b X-ray 3.3 A 318-419 None
4q0b X-ray 3.3 C 318-419 None
4q0b X-ray 3.3 D 318-419 None
4pqu X-ray 2.51 A 318-419 None
4pqu X-ray 2.51 B 318-419 None
4pqu X-ray 2.51 D 318-419 None
4pqu X-ray 2.51 C 318-419 None
4pwd X-ray 3 B 318-419 None
4pwd X-ray 3 A 318-419 None
4pwd X-ray 3 C 318-419 None
4pwd X-ray 3 D 318-419 None
3v81 X-ray 2.85 B 318-419  L-Bb 
3v81 X-ray 2.85 A 318-419  S-Bb L-Bb 
3v81 X-ray 2.85 D 318-419 None
3v81 X-ray 2.85 C 318-419 None
6b19 X-ray 4.5 B 318-419 None
6b19 X-ray 4.5 A 318-419 None
4r5p X-ray 2.89 D 318-419 None
4r5p X-ray 2.89 C 318-419  S-Bb L-Bb 
4r5p X-ray 2.89 B 318-419 None
4r5p X-ray 2.89 A 318-419 None
5hlf X-ray 2.95 B 318-419  L-Bb 
5hlf X-ray 2.95 A 318-419  S-Bb L-Bb 
5hlf X-ray 2.95 D 318-419  L-Bb 
5hlf X-ray 2.95 C 318-419  S-Bb L-Bb 
5txn X-ray 2.55 A 318-419  S-Bb L-Bb 
5txn X-ray 2.55 B 318-419  L-Bb 
5txn X-ray 2.55 D 318-419 None
5txn X-ray 2.55 C 318-419  S-Bb L-Bb 
3v4i X-ray 2.8 D 318-419 None
3v4i X-ray 2.8 C 318-419  S-Bb 
3v4i X-ray 2.8 B 318-419 None
3v4i X-ray 2.8 A 318-419 None
5txm X-ray 2.7 A 318-419  S-Bb L-Bb 
5txm X-ray 2.7 B 318-419 None
5txm X-ray 2.7 D 318-419 None
5txm X-ray 2.7 C 318-419  S-Bb 
5hro X-ray 2.75 B 318-419  L-Bb 
5hro X-ray 2.75 A 318-419  S-Bb L-Bb 
5hro X-ray 2.75 D 318-419  L-Bb 
5hro X-ray 2.75 C 318-419  S-Bb L-Bb 
5txo X-ray 2.55 B 318-419  L-Bb 
5txo X-ray 2.55 A 318-419  S-Bb L-Bb 
5txo X-ray 2.55 D 318-419 None
5txo X-ray 2.55 C 318-419  S-Bb L-Bb 
3v6d X-ray 2.7 B 318-419 None
3v6d X-ray 2.7 A 318-419  S-Bb L-Bb 
3v6d X-ray 2.7 D 318-419  H-Bb 
3v6d X-ray 2.7 C 318-419  S-Bb L-Bb 
5i42 X-ray 3.3 B 318-419 None
5i42 X-ray 3.3 A 318-419  S-Bb L-Bb 
5i42 X-ray 3.3 D 318-419 None
5i42 X-ray 3.3 C 318-419  S-Bb L-Bb 


© NPIDB team 2003 - 2019

text