Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: P03372
RecName: Estrogen receptor
Begin-End: 183-252
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
RYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRL
RKCYEVGMMK
Structures of the domain P03372 183-252
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1hcq X-ray 2.4 B 6-74  H-Bb H-Mj S-Bb L-Bb 
1hcq X-ray 2.4 A 6-74  H-Bb H-Mj S-Bb L-Bb 
1hcq X-ray 2.4 F 6-74  H-Bb H-Mj S-Bb L-Bb 
1hcq X-ray 2.4 E 6-74  H-Bb H-Mj S-Bb L-Bb 
4aa6 X-ray 2.6 F 184-252  H-Bb H-Mj S-Bb L-Bb 
4aa6 X-ray 2.6 E 184-252  H-Bb H-Mj S-Bb L-Bb 
4aa6 X-ray 2.6 B 184-252  H-Bb H-Mj S-Bb L-Bb 
4aa6 X-ray 2.6 A 184-252  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text