Pfam domain
Pfam family: TMV_coat (PF00721.20)
Uniprot AC: P03580
RecName: Capsid protein
Begin-End: 2-146
Organism: Ribgrass mosaic virus
Interaction Mode:   

Sequence:
SYNITNSNQYQYFAAVWAEPTPMLNQCVSALSQSYQTQAGRDTVRQQFANLLSTIVAPNQ
RFPDTGFRVYVNSAVIKPLYEALMKSFDTRNRIIETEEESRPSASEVANATQRVDDATVA
IRSQIQLLLNELSNGHGYMNRAEFE
Structures of the domain P03580 2-146
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1rmv X-ray 2.9 A 8-145 None


© NPIDB team 2003 - 2019

text