Pfam domain
Pfam family: Phage_G (PF02306.14)
Uniprot AC: P03643
RecName: Major spike protein G
Begin-End: 1-175
Organism: Enterobacteria phage phiX174 (Isolate Sanger)
Interaction Mode:   

Sequence:
MFQTFISRHNSNFFSDKLVLTSVTPASSAPVLQTPKATSSTLYFDSLTVNAGNGGFLHCI
QMDTSVNAANQVVSVGADIAFDADPKFFACLVRFESSSVPTTLPTAYDVYPLNGRHDGGY
YTVKDCVTIDVLPRTPGNNVYVGFMVWSNFTATKCRGLVSLNQVIKEIICLQPLK
Structures of the domain P03643 1-175
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2bpa X-ray 3 2 1-175 None


© NPIDB team 2003 - 2019

text