Pfam domain
Pfam family: Phage_integrase (PF00589.24)
Uniprot AC: P03700
RecName: Integrase
Begin-End: 178-338
Organism: Escherichia phage lambda
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj L-Mn 

Sequence:
SRLTADEYLKIYQAAESSPCWLRLAMELAVVTGQRVGDLCEMKWSDIVDGYLYVEQSKTG
VKIAIPTALHIDALGISMKETLDKCKEILGGETIIASTRREPLSSGTVSRYFMRARKASG
LSFEGDPPTFHELRSLSARLYEKQISDKFAQHLLGHKSDTM
Structures of the domain P03700 178-338
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1z19 X-ray 2.8 A 178-351  H-Bb H-Mj L-Bb L-Mj L-Mn 
1z1g X-ray 4.4 D 178-351  H-Bb H-Mj L-Bb L-Mj L-Mn 
1z1g X-ray 4.4 B 178-351  H-Bb H-Mj L-Bb L-Mn 
5j0n X-ray 11 G 178-351 None
5j0n X-ray 11 E 178-351 None


© NPIDB team 2003 - 2021

text