Pfam domain
Pfam family: Phage_integrase (PF00589.24)
Uniprot AC: P03700
RecName: Integrase
Begin-End: 178-347
Organism: Escherichia phage lambda
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
SRLTADEYLKIYQAAESSPCWLRLAMELAVVTGQRVGDLCEMKWSDIVDGYLYVEQSKTG
VKIAIPTALHIDALGISMKETLDKCKEILGGETIIASTRREPLSSGTVSRYFMRARKASG
LSFEGDPPTFHELRSLSARLYEKQISDKFAQHLLGHKSDTMASQYRDDRG
Structures of the domain P03700 178-347
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1z1b X-ray 3.8 B 178-343  H-Bb H-Mj L-Bb L-Mn 
1z1b X-ray 3.8 A 178-343  H-Bb H-Mj L-Bb L-Mn 
1p7d X-ray 2.95 B 178-343  H-Bb H-Mj L-Bb L-Mn 
1p7d X-ray 2.95 A 178-343  H-Bb H-Mj L-Bb L-Mn 
1z19 X-ray 2.8 B 178-343  H-Bb H-Mj L-Bb L-Mn 
1z1g X-ray 4.4 C 178-341  H-Bb H-Mj L-Bb L-Mj L-Mn 
1z1g X-ray 4.4 A 178-341  H-Bb H-Mj L-Bb 
5j0n X-ray 11 H 178-347 None
5j0n X-ray 11 F 178-347 None


© NPIDB team 2003 - 2021

text