Pfam domain
Pfam family: Phage_int_SAM_1 (PF02899.19)
Uniprot AC: P03700
RecName: Integrase
Begin-End: 80-158
Organism: Escherichia phage lambda
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
LDRYEKILASRGIKQKTLINYMSKIKAIRRGLPDAPLEDITTKEIAAMLNGYIDEGKAAS
AKLIRSTLSDAFREAIAEG
Structures of the domain P03700 80-158
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1z1b X-ray 3.8 B 80-158  H-Bb H-Mj L-Bb 
1z1b X-ray 3.8 A 80-158  H-Bb H-Mj L-Bb 
1p7d X-ray 2.95 B 80-158  H-Bb H-Mj L-Bb 
1p7d X-ray 2.95 A 80-158  H-Bb H-Mj L-Bb 
1z19 X-ray 2.8 A 80-158  H-Bb H-Mj L-Bb 
1z19 X-ray 2.8 B 80-158  H-Bb H-Mj L-Bb 
1z1g X-ray 4.4 D 80-158  H-Bb H-Mj L-Bb 
1z1g X-ray 4.4 C 80-158  H-Bb H-Mj L-Bb 
1z1g X-ray 4.4 B 80-158  H-Bb H-Mj L-Bb 
1z1g X-ray 4.4 A 80-158  H-Bb H-Mj L-Bb 
5j0n X-ray 11 H 80-158 None
5j0n X-ray 11 G 80-158 None
5j0n X-ray 11 E 80-158 None
5j0n X-ray 11 F 80-158 None


© NPIDB team 2003 - 2021

text