Pfam domain
Pfam family: LAGLIDADG_1 (PF00961.18)
Uniprot AC: P03880
RecName: Intron-encoded DNA endonuclease I-AniI
Begin-End: 243-339
Organism: Emericella nidulans
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
LVGLFEGDGYFSITKKGKYLTYELGIELSIKDVQLIYKIKKILGIGIVSFRKINEIEMVA
LRIRDKNHLKSFILPIFEKYPMFSNKQYDYLRFRNAL
Structures of the domain P03880 243-339
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1p8k X-ray 2.6 Z 9-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
3eh8 X-ray 2.7 G 9-104  H-Bb S-Bb S-Mj L-Mj 
3eh8 X-ray 2.7 D 9-104 None
3eh8 X-ray 2.7 A 9-104 None
2qoj X-ray 2.4 Z 9-104  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2020

text