Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.11)
Uniprot AC: P04051
RecName: DNA-directed RNA polymerase III subunit RPC1
Begin-End: 10-368
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb L-Bb 

Sequence:
PKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECAT
CHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELRR
PGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIHDTFRWVGKK
SAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCELLGIDATVP
SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLDKGISI
NNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNL
Structures of the domain P04051 10-368
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6f41 X-ray 4.3 A 11-368 None
6f44 X-ray 4.2 A 11-368 None
6eu0 X-ray 4 A 11-368  H-Bb L-Bb 
6f40 X-ray 3.7 A 11-368 None
6eu1 X-ray 3.4 A 11-368 None
5fj8 X-ray 3.9 A 11-368 None
6f42 X-ray 5.5 A 11-368  H-Bb 


© NPIDB team 2003 - 2020

text