Pfam domain
Pfam family: RNA_pol_Rpb1_3 (PF04983.17)
Uniprot AC: P04051
RecName: DNA-directed RNA polymerase III subunit RPC1
Begin-End: 540-717
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
NLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMK
PYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQI
LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDV
Structures of the domain P04051 540-717
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6f41 X-ray 4.3 A 540-717 None
6f44 X-ray 4.2 A 540-717 None
6eu0 X-ray 4 A 540-717 None
6f40 X-ray 3.7 A 540-717 None
6eu1 X-ray 3.4 A 540-717 None
5fj8 X-ray 3.9 A 540-717 None
6f42 X-ray 5.5 A 540-717 None


© NPIDB team 2003 - 2019

text