Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: P04150
RecName: Glucocorticoid receptor
Begin-End: 419-488
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
KLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRY
RKCLQAGMNL
Structures of the domain P04150 419-488
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4hn5 X-ray 1.9 A 419-487  H-Bb H-Mj S-Bb S-Mj L-Bb 
4hn5 X-ray 1.9 B 419-487  H-Bb H-Mj S-Bb L-Bb 
5e6c X-ray 2.2 B 419-487  H-Bb H-Mj L-Bb 
5e6c X-ray 2.2 A 419-487  H-Bb H-Mj S-Bb S-Mj L-Bb 
4hn6 X-ray 2.55 A 419-487  H-Bb H-Mj S-Bb S-Mj L-Bb 
4hn6 X-ray 2.55 B 419-487  H-Bb H-Mj S-Bb L-Bb 
5cbz X-ray 2.2 B 420-487  H-Bb H-Mj S-Bb S-Mj L-Bb 
5cbz X-ray 2.2 A 420-487  H-Bb H-Mj S-Bb L-Bb 
5cbz X-ray 2.2 F 420-487  H-Bb H-Mj S-Bb S-Mj L-Bb 
5cbz X-ray 2.2 E 420-487  H-Bb H-Mj S-Bb L-Bb 
5cby X-ray 2 B 420-487  H-Bb H-Mj S-Bb S-Mj L-Bb 
5cby X-ray 2 A 420-487  H-Bb H-Mj S-Bb L-Bb 
5emp X-ray 2.3 B 438-506 None
5emp X-ray 2.3 A 438-506 None
5emq X-ray 2.3 A 438-506  H-Bb H-Mj S-Bb L-Bb 
5emq X-ray 2.3 B 438-506  H-Bb H-Mj S-Bb L-Bb 
5cbx X-ray 2 A 420-487  H-Bb H-Mj S-Bb L-Bb 
5cbx X-ray 2 B 420-487  H-Bb H-Mj S-Bb S-Mj L-Bb 
5cbx X-ray 2 E 420-487  H-Bb H-Mj S-Bb S-Mj L-Bb 
5cbx X-ray 2 F 420-487  H-Bb H-Mj S-Bb L-Bb 
5emc X-ray 2.3 A 438-506 None
5emc X-ray 2.3 B 438-506 None
5e6d X-ray 2.4 B 419-487  H-Mj L-Bb L-Mj 
5e6d X-ray 2.4 A 419-487  H-Bb H-Mj S-Bb L-Bb 
5cc1 X-ray 2.3 A 419-487  H-Bb H-Mj S-Bb L-Bb 
5cc1 X-ray 2.3 B 419-487  H-Bb H-Mj S-Bb S-Mj L-Bb 
5cc1 X-ray 2.3 W 419-487  H-Bb H-Mj S-Bb L-Bb 
5cc1 X-ray 2.3 X 419-487  H-Bb H-Mj S-Bb S-Mj L-Bb 
5va7 X-ray 2.15 B 419-487  H-Bb S-Bb L-Bb 
5va7 X-ray 2.15 A 419-487  H-Bb H-Mj S-Bb L-Bb 
5va0 X-ray 2.3 A 419-487  H-Bb H-Mj S-Bb S-Mj L-Bb 
5va0 X-ray 2.3 B 419-487  H-Bb H-Mj S-Bb L-Bb 
5e69 X-ray 1.85 A 419-487  H-Bb H-Mj S-Bb L-Bb 
5e69 X-ray 1.85 B 419-487  H-Bb H-Mj L-Bb 
5e6a X-ray 2.2 A 419-487  H-Bb H-Mj S-Bb L-Bb 
5e6a X-ray 2.2 B 419-487  H-Bb H-Mj L-Bb 
5e6b X-ray 2.25 B 419-487  H-Bb H-Mj L-Bb 
5e6b X-ray 2.25 A 419-487  H-Bb H-Mj S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2019

text