Pfam domain
Pfam family: Ribosomal_L2 (PF00181.22)
Uniprot AC: P04257
RecName: 50S ribosomal protein L2
Begin-End: 61-118
Organism: Geobacillus stearothermophilus
Interaction Mode:   

Sequence:
QYRIIDFKRDKDGIPGRVATIEYDPNRSANIALINYADGEKRYIIAPKNLKVGMEIMS
Structures of the domain P04257 61-118
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1c04 X-ray 5 A 60-115 None
1ml5 X-ray 14 d 60-117 None


© NPIDB team 2003 - 2019

text