Pfam domain
Pfam family: Endonuc-EcoRV (PF09233.10)
Uniprot AC: P04390
RecName: Type-2 restriction enzyme EcoRV
Begin-End: 10-241
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 

Sequence:
ALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHGYIVEEPKQQ
NHYPDFTLYKPSEPNKKIAIDIKTTYTNKENEKIKFTLGGYTSFIRNNTKNIVYPFDQYI
AHWIIGYVYTRVATRKSSLKTYNINELNEIPKPYKGVKVFLQDKWVIAGDLAGSGNTTNI
GSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIY
Structures of the domain P04390 10-241
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1eo4 X-ray 1.9 A 12-239 None
1eo4 X-ray 1.9 B 12-239 None
4rve X-ray 3 B 12-239  H-Mn S-Bb S-Mj L-Bb L-Mj 
4rve X-ray 3 A 12-239  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 
4rve X-ray 3 B 12-239  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 
4rve X-ray 3 C 12-239  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 
1eop X-ray 2.6 A 20-239  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1eop X-ray 2.6 B 12-239  S-Bb S-Mj L-Bb L-Mj 
1bua X-ray 2.15 B 19-239 None
1bua X-ray 2.15 A 12-239 None
1az0 X-ray 2 B 19-239  H-Bb S-Bb S-Mj L-Bb L-Mj 
1az0 X-ray 2 A 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj 
1bss X-ray 2.15 A 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1bss X-ray 2.15 B 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1eon X-ray 1.6 A 12-239 None
1eon X-ray 1.6 B 12-239 None
1rvc X-ray 2.1 A 12-239 None
1rvc X-ray 2.1 B 12-239 None
1b96 X-ray 2.3 A 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1b96 X-ray 2.3 B 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1sx5 X-ray 1.5 A 12-239 None
1sx5 X-ray 1.5 B 12-239 None
1eoo X-ray 2.16 A 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj 
1eoo X-ray 2.16 B 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj 
1rv5 X-ray 2.1 A 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj 
1rv5 X-ray 2.1 B 20-239  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1rvb X-ray 2.1 A 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1rvb X-ray 2.1 B 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj 
1eo3 X-ray 2 A 12-239 None
1eo3 X-ray 2 B 12-239 None
1b95 X-ray 2.05 A 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1b95 X-ray 2.05 B 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1rva X-ray 2 A 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj 
1rva X-ray 2 B 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2b0e X-ray 1.9 A 12-239 None
2b0e X-ray 1.9 B 12-239 None
1bsu X-ray 2 B 19-239 None
1bsu X-ray 2 A 12-239 None
1b97 X-ray 1.9 A 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj 
1b97 X-ray 1.9 B 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj 
2rve X-ray 3 B 20-234 None
2rve X-ray 3 A 19-234 None
1bgb X-ray 2 B 20-239  H-Bb S-Bb S-Mj L-Bb L-Mj 
1bgb X-ray 2 A 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj 
2b0d X-ray 2 A 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj 
2b0d X-ray 2 B 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
5hlk X-ray 2 A 12-239 None
5hlk X-ray 2 B 12-239 None
1suz X-ray 1.8 A 12-239 None
1suz X-ray 1.8 B 12-239 None
5f8a X-ray 1.76 A 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj 
5f8a X-ray 1.76 B 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj 
1stx X-ray 2.1 B 12-239 None
1stx X-ray 2.1 A 12-239 None
1sx8 X-ray 2.15 B 12-239 None
1sx8 X-ray 2.15 A 12-239 None
1b94 X-ray 1.9 B 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1b94 X-ray 1.9 A 12-239  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2019

text