Pfam domain
Pfam family: AlkA_N (PF06029.10)
Uniprot AC: P04395
RecName: DNA-3-methyladenine glycosylase 2
Begin-End: 1-112
Organism: Escherichia coli
Interaction Mode:   

Sequence:
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLH
INLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVD
Structures of the domain P04395 1-112
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3ogd X-ray 2.8 A 3-112 None
3oh6 X-ray 2.89 A 3-112 None
3oh6 X-ray 2.89 A 3-112 None
3cvs X-ray 2.4 C 3-112 None
3cvs X-ray 2.4 A 3-112 None
3cvs X-ray 2.4 B 3-112 None
3cvs X-ray 2.4 D 3-112 None
3d4v X-ray 2.9 B 3-112 None
3d4v X-ray 2.9 D 3-112 None
3d4v X-ray 2.9 A 3-112 None
3d4v X-ray 2.9 C 3-112 None
3oh9 X-ray 2.8 A 3-112 None
3cwu X-ray 2.8 D 3-112 None
3cwu X-ray 2.8 C 3-112 None
3cwu X-ray 2.8 B 3-112 None
3cwu X-ray 2.8 A 3-112 None
1diz X-ray 2.5 B 3-112 None
1diz X-ray 2.5 A 3-112 None
3cwa X-ray 2.4 D 3-112 None
3cwa X-ray 2.4 C 3-112 None
3cwa X-ray 2.4 A 3-112 None
3cwa X-ray 2.4 B 3-112 None
3cvt X-ray 2.5 D 3-112 None
3cvt X-ray 2.5 A 3-112 None
3cvt X-ray 2.5 C 3-112 None
3cvt X-ray 2.5 B 3-112 None
3cw7 X-ray 2.3 D 3-112 None
3cw7 X-ray 2.3 C 3-112 None
3cw7 X-ray 2.3 A 3-112 None
3cw7 X-ray 2.3 B 3-112 None
3cws X-ray 2.3 A 3-112 None
3cws X-ray 2.3 B 3-112 None
3cws X-ray 2.3 C 3-112 None
3cws X-ray 2.3 D 3-112 None
3cwt X-ray 2.3 D 3-112 None
3cwt X-ray 2.3 C 3-112 None
3cwt X-ray 2.3 A 3-112 None
3cwt X-ray 2.3 B 3-112 None


© NPIDB team 2003 - 2020

text