Pfam domain
Pfam family: HhH-GPD (PF00730.24)
Uniprot AC: P04395
RecName: DNA-3-methyladenine glycosylase 2
Begin-End: 118-266
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mn L-Bb L-Mj L-Mn 

Sequence:
VRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLK
RAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPD
DYLIKQRFPGMTPAQIRRYAERWKPWRSY
Structures of the domain P04395 118-266
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3ogd X-ray 2.8 A 118-240 None
3cvs X-ray 2.4 D 118-240 None
3cvs X-ray 2.4 C 118-240 None
3cvs X-ray 2.4 B 118-240 None
3cvs X-ray 2.4 A 118-240 None
3oh6 X-ray 2.89 A 118-241 None
3oh6 X-ray 2.89 A 118-241 None
3d4v X-ray 2.9 A 118-240 None
3d4v X-ray 2.9 B 118-240 None
3d4v X-ray 2.9 D 118-240 None
3d4v X-ray 2.9 C 118-240 None
3oh9 X-ray 2.8 A 118-241 None
3cwu X-ray 2.8 D 118-240 None
3cwu X-ray 2.8 C 118-240 None
3cwu X-ray 2.8 B 118-240 None
3cwu X-ray 2.8 A 118-240 None
1diz X-ray 2.5 A 118-240 None
1diz X-ray 2.5 B 118-240 None
3cwa X-ray 2.4 D 118-240  H-Bb L-Bb 
3cwa X-ray 2.4 A 118-240  H-Bb L-Bb 
3cwa X-ray 2.4 B 118-240  H-Bb L-Bb L-Mj L-Mn 
3cwa X-ray 2.4 C 118-240  H-Bb H-Mn L-Bb L-Mj 
3cvt X-ray 2.5 D 118-240 None
3cvt X-ray 2.5 C 118-240 None
3cvt X-ray 2.5 B 118-240 None
3cvt X-ray 2.5 A 118-240 None
3cw7 X-ray 2.3 D 118-240 None
3cw7 X-ray 2.3 C 118-240 None
3cw7 X-ray 2.3 B 118-240 None
3cw7 X-ray 2.3 A 118-240 None
3cws X-ray 2.3 D 118-240 None
3cws X-ray 2.3 C 118-240 None
3cws X-ray 2.3 B 118-240 None
3cws X-ray 2.3 A 118-240 None
3cwt X-ray 2.3 D 118-240 None
3cwt X-ray 2.3 C 118-240 None
3cwt X-ray 2.3 B 118-240 None
3cwt X-ray 2.3 A 118-240 None


© NPIDB team 2003 - 2019

text