Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.18)
Uniprot AC: P04415
RecName: DNA-directed DNA polymerase
Begin-End: 88-290
Organism: Enterobacteria phage T4
Interaction Mode:   

Sequence:
LAYISDTYGSEIVYDRKFVRVANCDIEVTGDKFPDPMKAEYEIDAITHYDSIDDRFYVFD
LLNSMYGSVSKWDAKLAAKLDCEGGDEVPQEILDRVIYMPFDNERDMLMEYINLWEQKRP
AIFTGWNIEGFDVPYIMNRVKMILGERSMKRFSPIGRVKSKLIQNMYGSKEIYSIDGVSI
LDYLDLYKKFAFTNLPSFSLESV
Structures of the domain P04415 88-290
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1noy X-ray 2.2 A 164-290 None
1noy X-ray 2.2 B 111-290 None


© NPIDB team 2003 - 2020

text