Pfam domain
Pfam family: Ribosomal_L24e (PF01246.19)
Uniprot AC: P04449
RecName: 60S ribosomal protein L24-A
Begin-End: 1-56
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFR
Structures of the domain P04449 1-56
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2x7n X-ray 11.8 D 1-56 None


© NPIDB team 2003 - 2019

text