Pfam domain
Pfam family: gp45-slide_C (PF09116.9)
Uniprot AC: P04525
RecName: DNA polymerase clamp
Begin-End: 115-222
Organism: Enterobacteria phage T4
Interaction Mode:  H-Bb 

Sequence:
VTEIKAEDLQQLLRVSRGLQIDTIAITVKEGKIVINGFNKVEDSALTRVKYSLTLGDYDG
ENTFNFIINMANMKMQPGNYKLLLWAKGKQGAAKFEGEHANYVVALEA
Structures of the domain P04525 115-222
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3u5z X-ray 3.5 F 7115-7222  H-Bb 
3u5z X-ray 3.5 H 6115-6222  H-Bb 
3u5z X-ray 3.5 G 5115-5222 None
3u5z X-ray 3.5 P 7115-7222 None
3u5z X-ray 3.5 R 6115-6222 None
3u5z X-ray 3.5 Q 5115-5222 None
3u60 X-ray 3.34 F 7115-7222 None
3u60 X-ray 3.34 H 6115-6222 None
3u60 X-ray 3.34 G 5115-5222 None
3u61 X-ray 3.2 F 3115-3222 None
3u61 X-ray 3.2 H 2115-2222 None
3u61 X-ray 3.2 G 1115-1222 None


© NPIDB team 2003 - 2019

text