Pfam domain
Pfam family: T4-Gluco-transf (PF09198.9)
Uniprot AC: P04547
RecName: DNA beta-glucosyltransferase
Begin-End: 1-38
Organism: Enterobacteria phage T4
Interaction Mode:   

Sequence:
MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVD
Structures of the domain P04547 1-38
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1m5r X-ray 1.8 B 1-38 None
1m5r X-ray 1.8 A 1-38 None
1ixy X-ray 2.5 B 1-38 None
1ixy X-ray 2.5 A 1-38 None
1sxq X-ray 1.8 A 1-38 None
1sxq X-ray 1.8 B 1-38 None
1sxp X-ray 2.5 A 1-38 None
1sxp X-ray 2.5 B 1-38 None


© NPIDB team 2003 - 2019

text