Pfam domain
Pfam family: RNase_H (PF00075.23)
Uniprot AC: P04585
RecName: Gag-Pol polyprotein
Begin-End: 1023-1143
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)
Interaction Mode:  H-Bb L-Bb L-Mn 

Sequence:
GAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNI
VTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
I
Structures of the domain P04585 1023-1143
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3kk1 X-ray 2.7 A 438-554  H-Bb L-Bb 
3kk2 X-ray 2.9 A 438-554  L-Bb L-Mn 
3kjv X-ray 3.1 A 438-555  H-Bb L-Bb L-Mn 
3kk3 X-ray 2.9 A 438-554  L-Bb L-Mn 
6bsj X-ray 2.89 A 438-556 None
5j2p X-ray 2.53 A 438-556  H-Bb L-Bb L-Mn 
6bsg X-ray 2.44 A 438-556 None
5j2m X-ray 2.43 A 438-556  H-Bb L-Bb L-Mn 
6bsh X-ray 2.65 A 438-556 None
5j2q X-ray 2.79 A 438-556  H-Bb L-Bb 
5j2n X-ray 2.9 A 438-556  H-Bb L-Bb L-Mn 
6bsi X-ray 3.25 A 438-556 None


© NPIDB team 2003 - 2019

text