Pfam domain
Pfam family: RVT_1 (PF00078.26)
Uniprot AC: P04585
RecName: Gag-Pol polyprotein
Begin-End: 650-821
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)
Interaction Mode:  S-Bb S-Mn L-Bb L-Mn 

Sequence:
IKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDE
DFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQ
YMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYEL
Structures of the domain P04585 650-821
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3kk1 X-ray 2.7 B 63-241 None
3kk1 X-ray 2.7 A 63-232  S-Bb S-Mn L-Bb 
1rtd X-ray 3.2 B 63-215 None
1rtd X-ray 3.2 D 63-215 None
3kk2 X-ray 2.9 A 63-232  S-Bb S-Mn L-Bb L-Mn 
3kk2 X-ray 2.9 B 63-215 None
3kjv X-ray 3.1 B 63-209 None
3kjv X-ray 3.1 A 63-232  S-Bb S-Mn L-Bb L-Mn 
1t05 X-ray 3 B 63-215 None
3kk3 X-ray 2.9 B 63-241 None
3kk3 X-ray 2.9 A 63-232  S-Bb S-Mn L-Bb L-Mn 
6bsj X-ray 2.89 B 65-234 None
5j2p X-ray 2.53 A 63-232 None
5j2p X-ray 2.53 B 63-241 None
6bsg X-ray 2.44 B 63-234 None
6bsg X-ray 2.44 A 75-232 None
5j2m X-ray 2.43 B 101-241 None
5j2m X-ray 2.43 A 63-232 None
6bsh X-ray 2.65 B 63-234 None
5j2q X-ray 2.79 B 63-240 None
5j2q X-ray 2.79 A 63-232 None
5j2n X-ray 2.9 B 63-241 None
5j2n X-ray 2.9 A 63-232 None
6bsi X-ray 3.25 B 65-238 None


© NPIDB team 2003 - 2019

text