Pfam domain
Pfam family: RVT_1 (PF00078.26)
Uniprot AC: P04585
RecName: Gag-Pol polyprotein
Begin-End: 662-821
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)
Interaction Mode:   

Sequence:
VDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPS
INNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLE
IGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYEL
Structures of the domain P04585 662-821
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bsj X-ray 2.89 A 75-232 None
6bsh X-ray 2.65 A 75-232 None
6bsi X-ray 3.25 A 75-232 None


© NPIDB team 2003 - 2020

text