Pfam domain
Pfam family: RVT_thumb (PF06817.13)
Uniprot AC: P04585
RecName: Gag-Pol polyprotein
Begin-End: 828-891
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)
Interaction Mode:  H-Bb H-Mn L-Bb 

Sequence:
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELA
Structures of the domain P04585 828-891
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3kk1 X-ray 2.7 B 242-303 None
3kk1 X-ray 2.7 A 242-303  H-Bb 
1rtd X-ray 3.2 B 242-303 None
1rtd X-ray 3.2 D 242-303 None
3kk2 X-ray 2.9 B 242-303 None
3kk2 X-ray 2.9 A 242-303  H-Bb L-Bb 
3kjv X-ray 3.1 B 242-303 None
3kjv X-ray 3.1 A 242-303  H-Bb L-Bb 
1t05 X-ray 3 B 242-303 None
3kk3 X-ray 2.9 B 242-303 None
3kk3 X-ray 2.9 A 242-303  H-Bb H-Mn L-Bb 
6bsj X-ray 2.89 B 242-303 None
6bsj X-ray 2.89 A 242-303 None
5j2p X-ray 2.53 B 242-303 None
5j2p X-ray 2.53 A 242-303  L-Bb 
6bsg X-ray 2.44 B 242-303 None
6bsg X-ray 2.44 A 242-303 None
5j2m X-ray 2.43 B 242-303 None
5j2m X-ray 2.43 A 242-303  L-Bb 
6bsh X-ray 2.65 B 242-303 None
6bsh X-ray 2.65 A 242-303 None
5j2q X-ray 2.79 B 242-303 None
5j2q X-ray 2.79 A 242-303 None
5j2n X-ray 2.9 B 242-303 None
5j2n X-ray 2.9 A 242-303  L-Bb 
6bsi X-ray 3.25 B 242-303 None
6bsi X-ray 3.25 A 242-303 None


© NPIDB team 2003 - 2019

text