Pfam domain
Pfam family: P53 (PF00870.17)
Uniprot AC: P04637
RecName: Cellular tumor antigen p53
Begin-End: 99-289
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj L-Mn 

Sequence:
SQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVR
AMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVV
PYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACP
GRDRRTEEENL
Structures of the domain P04637 99-289
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ac0 X-ray 1.8 C 96-288  H-Mj S-Bb L-Bb L-Mj 
2ac0 X-ray 1.8 D 96-288  H-Mj S-Bb L-Bb L-Mj 
2ac0 X-ray 1.8 A 95-288  H-Mj S-Bb L-Bb L-Mj 
2ac0 X-ray 1.8 B 95-288  H-Mj S-Bb L-Bb L-Mj 
2ata X-ray 2.2 A 96-288 None
2ata X-ray 2.2 B 95-288 None
2ata X-ray 2.2 C 96-288 None
2ata X-ray 2.2 D 95-288 None
2ady X-ray 2.5 A 95-288  H-Mj S-Bb L-Bb L-Mj 
2ady X-ray 2.5 B 95-288  H-Mj S-Bb L-Bb L-Mj 
1tup X-ray 2.2 A 95-288  H-Bb L-Bb 
1tup X-ray 2.2 B 96-288  H-Mj S-Bb L-Bb L-Mj 
1tup X-ray 2.2 C 95-288 None
3igk X-ray 1.7 A 95-288 None
1tsr X-ray 2.2 C 95-288 None
1tsr X-ray 2.2 B 96-288  H-Mj S-Bb L-Bb L-Mj 
1tsr X-ray 2.2 A 95-288  H-Bb L-Bb 
3d0a X-ray 1.8 B 95-288  H-Mj S-Bb L-Bb L-Mj 
3d0a X-ray 1.8 A 96-288  H-Mj S-Bb L-Bb L-Mj 
3d0a X-ray 1.8 D 95-288  H-Mj S-Bb L-Bb L-Mj 
3d0a X-ray 1.8 C 96-288  H-Mj S-Bb L-Bb L-Mj 
3kz8 X-ray 1.91 B 95-288 None
3kz8 X-ray 1.91 A 95-288 None
3igl X-ray 1.8 A 95-288 None
4hje X-ray 1.91 A 95-288 None
4hje X-ray 1.91 B 95-288 None
4hje X-ray 1.91 C 95-288  H-Mj S-Bb L-Bb L-Mj 
4hje X-ray 1.91 D 95-288  H-Mj S-Bb L-Bb L-Mj 
4ibv X-ray 2.1 A 95-288 None
2ahi X-ray 1.85 D 96-288  H-Mj S-Bb L-Bb L-Mj 
2ahi X-ray 1.85 C 96-288  H-Mj S-Bb L-Bb L-Mj 
2ahi X-ray 1.85 A 95-288  H-Mj S-Bb S-Mj L-Bb L-Mj L-Mn 
2ahi X-ray 1.85 B 95-288  H-Mj S-Bb L-Bb L-Mj 
4ibu X-ray 1.7 D 95-288  H-Mj L-Bb L-Mj 
4ibu X-ray 1.7 C 96-288  H-Bb H-Mj L-Bb L-Mj 
4ibu X-ray 1.7 A 96-288  H-Mj S-Mj L-Bb L-Mj 
4ibu X-ray 1.7 B 95-288  H-Bb H-Mj L-Bb L-Mj 
3q06 X-ray 3.2 A 96-288  H-Mj S-Bb L-Bb L-Mj 
3q06 X-ray 3.2 C 96-288  H-Mj L-Bb L-Mj 
3q06 X-ray 3.2 D 96-288  H-Mj S-Bb L-Bb L-Mj 
3q06 X-ray 3.2 B 96-288  H-Mj L-Bb L-Mj 
4ibw X-ray 1.79 A 95-288 None
3kmd X-ray 2.15 C 95-288  H-Mj S-Bb L-Bb L-Mj 
3kmd X-ray 2.15 D 95-288  H-Mj S-Bb L-Bb L-Mj 
3kmd X-ray 2.15 B 95-288  H-Mj S-Bb L-Bb L-Mj 
3kmd X-ray 2.15 A 95-288  H-Mj S-Bb L-Bb L-Mj 
3q05 X-ray 2.4 B 95-288  H-Mj S-Bb L-Bb L-Mj 
3q05 X-ray 2.4 D 95-288  H-Bb H-Mj S-Bb L-Bb L-Mj 
3q05 X-ray 2.4 C 95-288  H-Mj S-Bb L-Bb L-Mj 
3q05 X-ray 2.4 A 95-288  H-Bb H-Mj S-Bb L-Bb L-Mj 
3ts8 X-ray 2.8 D 95-288  H-Mj S-Bb L-Bb L-Mj 
3ts8 X-ray 2.8 C 95-288  H-Mj S-Bb L-Bb L-Mj 
3ts8 X-ray 2.8 B 95-288  H-Mj S-Bb L-Bb L-Mj 
3ts8 X-ray 2.8 A 95-288  H-Mj S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2019

text