Pfam domain
Pfam family: tRNA_anti-codon (PF01336.27)
Uniprot AC: P04802
RecName: Aspartate--tRNA ligase, cytoplasmic
Begin-End: 109-197
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VLFRARVHNTRQQGATLAFLTLRQQASLIQGLVKANKEGTISKNMVKWAGSLNLESIVLV
RGIVKKVDEPIKSATVQNLEIHITKIYTI
Structures of the domain P04802 109-197
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1asz X-ray 3 B 109-197 None
1asz X-ray 3 A 109-197 None
1asy X-ray 2.9 B 109-197 None
1asy X-ray 2.9 A 109-197 None


© NPIDB team 2003 - 2021

text