Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P04908
RecName: Histone H2A type 1-B/E
Begin-End: 10-91
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
KARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGN
AARDNKKTRIIPRHLQLAIRND
Structures of the domain P04908 10-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gse X-ray 3.14 G 13-88  H-Bb S-Bb L-Bb 
5jrg X-ray 2.5 G 15-88  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text