Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P04908
RecName: Histone H2A type 1-B/E
Begin-End: 16-91
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
KTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNK
KTRIIPRHLQLAIRND
Structures of the domain P04908 16-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xf4 X-ray 2.87 G 18-88 None
5xf4 X-ray 2.87 C 18-88 None
5x7x X-ray 2.18 G 18-88  H-Bb S-Bb L-Bb 
5x7x X-ray 2.18 C 15-88  H-Bb S-Bb L-Bb 
3azl X-ray 2.7 G 18-88  H-Bb S-Bb L-Bb 
3azl X-ray 2.7 C 15-88  H-Bb S-Bb L-Bb 
2cv5 X-ray 2.5 G 18-88  H-Bb S-Bb L-Bb 
2cv5 X-ray 2.5 C 15-88  H-Bb S-Bb L-Bb 
5av9 X-ray 2.2 G 18-88 None
5av9 X-ray 2.2 C 17-88 None
5b40 X-ray 3.33 G 18-88 None
5b40 X-ray 3.33 C 18-88 None
5ay8 X-ray 2.8 G 18-88  H-Bb S-Bb L-Bb 
5ay8 X-ray 2.8 C 18-88  H-Bb S-Bb L-Bb 
3azg X-ray 2.4 G 18-88  H-Bb S-Bb L-Bb 
3azg X-ray 2.4 C 15-88  H-Bb S-Bb L-Bb 
3w98 X-ray 3.42 G 18-88  H-Bb S-Bb L-Bb 
3w98 X-ray 3.42 C 17-88  H-Bb S-Bb L-Bb 
3afa X-ray 2.5 C 15-88  H-Bb S-Bb L-Bb 
3afa X-ray 2.5 G 18-88  H-Bb S-Bb L-Bb 
3av1 X-ray 2.5 G 18-88  H-Bb S-Bb L-Bb 
3av1 X-ray 2.5 C 18-88  H-Bb S-Bb L-Bb 
3azi X-ray 2.7 G 18-88  H-Bb S-Bb L-Bb 
3azi X-ray 2.7 C 15-88  H-Bb S-Bb L-Bb 
3av2 X-ray 2.8 G 18-88  H-Bb S-Bb L-Bb 
3av2 X-ray 2.8 C 18-88  H-Bb S-Bb L-Bb 
3azf X-ray 2.7 G 18-88  H-Bb S-Bb L-Bb 
3azf X-ray 2.7 C 15-88  H-Bb S-Bb L-Bb 
3aze X-ray 3 G 18-88  S-Bb L-Bb 
3aze X-ray 3 C 15-88  H-Bb S-Bb L-Bb 
3azj X-ray 2.89 G 18-88  H-Bb S-Bb L-Bb 
3azj X-ray 2.89 C 15-88  H-Bb S-Bb L-Bb 
3azk X-ray 3.2 G 18-88  H-Bb S-Bb L-Bb 
3azk X-ray 3.2 C 15-88  H-Bb S-Bb L-Bb 
3azm X-ray 2.89 C 17-88  H-Bb S-Bb L-Bb 
3azm X-ray 2.89 G 18-88  H-Bb S-Bb L-Bb 
3ayw X-ray 2.9 G 19-88  H-Bb S-Bb L-Bb 
3ayw X-ray 2.9 C 15-88  H-Bb S-Bb L-Bb 
3azn X-ray 3 G 18-88  H-Bb S-Bb L-Bb 
3azn X-ray 3 C 15-88  H-Bb S-Bb L-Bb 
3a6n X-ray 2.7 G 18-88  H-Bb S-Bb L-Bb 
3a6n X-ray 2.7 C 18-88  H-Bb S-Bb L-Bb 
3an2 X-ray 3.6 G 18-88 None
3an2 X-ray 3.6 C 19-88 None
3azh X-ray 3.49 G 18-88  H-Bb S-Bb L-Bb 
3azh X-ray 3.49 C 17-88  H-Bb S-Bb L-Bb 
3w96 X-ray 3 G 19-88 None
3w96 X-ray 3 C 16-88 None
3w97 X-ray 3.2 G 19-88  H-Bb S-Bb L-Bb 
3w97 X-ray 3.2 C 17-88  H-Bb S-Bb L-Bb 
5xf3 X-ray 2.6 G 18-88 None
5xf3 X-ray 2.6 C 18-88 None
3wtp X-ray 2.67 G 18-88  H-Bb S-Bb 
3wtp X-ray 2.67 C 16-88  H-Bb S-Bb L-Bb 
5av6 X-ray 2.2 C 17-88 None
5av6 X-ray 2.2 G 18-88 None
5cpi X-ray 2.9 G 18-88  H-Bb S-Bb L-Bb 
5cpi X-ray 2.9 C 15-88  H-Bb S-Bb L-Bb 
3wkj X-ray 2.8 G 18-88  H-Bb S-Bb L-Bb 
3wkj X-ray 2.8 C 16-88  H-Bb S-Bb L-Bb 
3x1s X-ray 2.81 G 18-88  H-Bb S-Bb 
3x1s X-ray 2.81 C 18-88  H-Bb S-Bb L-Bb 
5cpk X-ray 2.63 G 18-88 None
5cpk X-ray 2.63 C 17-88 None
4ym6 X-ray 3.51 G 18-88  H-Bb S-Bb L-Bb 
4ym6 X-ray 3.51 C 15-88  S-Bb L-Bb 
5b0z X-ray 1.99 G 18-88  H-Bb S-Bb L-Bb 
5b0z X-ray 1.99 C 15-88  H-Bb S-Bb L-Bb 
5b2j X-ray 2.6 G 18-88 None
5b2j X-ray 2.6 C 17-88 None
5gxq X-ray 2.85 C 15-88  H-Bb S-Bb L-Bb 
5gxq X-ray 2.85 G 18-88  H-Bb L-Bb 
4ym5 X-ray 4.01 G 19-88  H-Bb S-Bb L-Bb 
4ym5 X-ray 4.01 C 18-88  H-Bb S-Bb L-Bb 
5av8 X-ray 2.2 G 18-88 None
5av8 X-ray 2.2 C 17-88 None
5gtc X-ray 2.7 G 16-88  H-Bb S-Bb L-Bb 
5gtc X-ray 2.7 C 15-88  H-Bb S-Bb L-Bb 
5b24 X-ray 3.6 G 18-88  H-Bb S-Bb L-Bb 
5b24 X-ray 3.6 C 15-88  H-Bb S-Bb L-Bb 
4z5t X-ray 2.8 G 18-88  H-Bb S-Bb L-Bb 
4z5t X-ray 2.8 C 18-88  H-Bb S-Bb L-Bb 
5av5 X-ray 2.4 G 18-88 None
5av5 X-ray 2.4 C 17-88 None
5b2i X-ray 3 G 18-88 None
5b2i X-ray 3 C 17-88 None
5gse X-ray 3.14 M 16-88  H-Bb S-Bb L-Bb 
5gse X-ray 3.14 C 19-88  H-Bb S-Bb L-Bb 
5b0y X-ray 2.56 G 18-88  H-Bb S-Bb L-Bb 
5b0y X-ray 2.56 C 18-88  H-Bb S-Bb L-Bb 
5cpj X-ray 3.15 G 18-88 None
5cpj X-ray 3.15 C 18-88 None
5avb X-ray 2.4 G 18-88 None
5avb X-ray 2.4 C 17-88 None
6etx X-ray 4.8 O 18-88 None
6etx X-ray 4.8 K 17-88 None
5avc X-ray 2.4 G 18-88 None
5avc X-ray 2.4 C 17-88 None
5b32 X-ray 2.35 C 15-88  H-Bb S-Bb L-Bb 
6buz X-ray 3.92 G 16-89 None
6buz X-ray 3.92 C 16-89 None
5xf5 X-ray 2.82 G 18-88 None
5xf5 X-ray 2.82 C 18-88 None
3x1v X-ray 2.92 G 15-88  H-Bb S-Bb L-Bb 
3x1v X-ray 2.92 C 17-88  H-Bb S-Bb L-Bb 
5b31 X-ray 2.2 C 17-88  H-Bb S-Bb L-Bb 
5jrg X-ray 2.5 C 16-88  H-Bb S-Bb L-Bb 
3w99 X-ray 3 C 18-88  H-Bb S-Bb L-Bb 
3w99 X-ray 3 G 20-88  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text