Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P04908
RecName: Histone H2A type 1-B/E
Begin-End: 16-91
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb S-Mn L-Bb L-Mn 

Sequence:
KTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNK
KTRIIPRHLQLAIRND
Structures of the domain P04908 16-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x7x X-ray 2.18 G 14-90  H-Bb S-Bb S-Mn L-Bb 
5x7x X-ray 2.18 C 11-90  H-Bb S-Bb S-Mn L-Bb 
3w98 X-ray 3.42 C 13-90  H-Bb S-Bb L-Bb 
3w98 X-ray 3.42 G 15-90  H-Bb S-Bb L-Bb 
3azl X-ray 2.7 G 14-90  H-Bb S-Bb L-Bb 
3azl X-ray 2.7 C 11-90  H-Bb S-Bb L-Bb L-Mn 
6j4y X-ray 4.3 g 1-77 None
6j4y X-ray 4.3 c 4-78 None
5xf4 X-ray 2.87 G 14-90 None
5xf4 X-ray 2.87 C 14-90 None
2cv5 X-ray 2.5 G 15-90  H-Bb S-Bb L-Bb 
2cv5 X-ray 2.5 C 11-90  H-Bb S-Bb L-Bb L-Mn 
5cpk X-ray 2.63 G 15-90  H-Bb S-Bb L-Bb 
5cpk X-ray 2.63 C 13-90  H-Bb L-Bb 
5z23 X-ray 2.73 G 15-90  H-Bb S-Bb L-Bb 
5z23 X-ray 2.73 C 12-90  H-Bb S-Bb L-Bb 
5av9 X-ray 2.2 G 14-90 None
5av9 X-ray 2.2 C 13-90 None
6a5r X-ray 8.7 c 16-90 None
6a5r X-ray 8.7 g 1-74 None
6t7b X-ray 5.1 G 13-90  H-Bb S-Bb L-Bb 
6t7b X-ray 5.1 C 13-90  H-Bb S-Bb 
3x1s X-ray 2.81 G 15-90  H-Bb S-Bb 
3x1s X-ray 2.81 C 14-90  H-Bb S-Bb L-Bb 
3x1v X-ray 2.92 G 11-90  H-Bb S-Bb L-Bb 
3x1v X-ray 2.92 C 13-90  H-Bb S-Bb L-Bb 
6l9h X-ray 2.6 G 14-90 None
6l9h X-ray 2.6 C 16-90 None
6hts X-ray 4.8 K 13-90 None
6hts X-ray 4.8 O 14-90 None
6j4z X-ray 4.1 c 4-78 None
6j4z X-ray 4.1 g 14-90 None
6t93 X-ray 3.49 G 12-91  H-Bb S-Bb L-Bb 
6t93 X-ray 3.49 C 12-91  H-Bb S-Bb L-Bb L-Mn 
6jr1 X-ray 2.4 G 14-89  H-Bb S-Bb S-Mn L-Bb 
6jr1 X-ray 2.4 C 11-89  H-Bb S-Bb S-Mn L-Bb 
3wtp X-ray 2.67 G 14-90  H-Bb S-Bb 
3wtp X-ray 2.67 C 12-90  H-Bb S-Bb L-Bb 
3azg X-ray 2.4 G 15-90  H-Bb S-Bb L-Bb 
3azg X-ray 2.4 C 11-90  H-Bb S-Bb L-Bb 
6buz X-ray 3.92 G 12-91 None
6buz X-ray 3.92 C 12-91 None
3afa X-ray 2.5 G 15-90  H-Bb S-Bb L-Bb 
3afa X-ray 2.5 C 11-90  H-Bb S-Bb S-Mn L-Bb 
3av1 X-ray 2.5 G 15-90  H-Bb S-Bb L-Bb 
3av1 X-ray 2.5 C 14-90  H-Bb S-Bb S-Mn L-Bb 
3azi X-ray 2.7 G 15-90  H-Bb S-Bb L-Bb 
3azi X-ray 2.7 C 11-90  H-Bb S-Bb L-Bb 
3av2 X-ray 2.8 G 15-90  H-Bb S-Bb L-Bb 
3av2 X-ray 2.8 C 14-90  H-Bb S-Bb L-Bb 
3azf X-ray 2.7 G 15-90  H-Bb S-Bb L-Bb 
3azf X-ray 2.7 C 11-90  H-Bb S-Bb S-Mn L-Bb L-Mn 
3aze X-ray 3 G 15-90  H-Bb S-Bb L-Bb 
3aze X-ray 3 C 11-90  H-Bb S-Bb L-Bb 
3azj X-ray 2.89 G 15-90  H-Bb S-Bb L-Bb 
3azj X-ray 2.89 C 11-90  H-Bb S-Bb L-Bb 
3azk X-ray 3.2 G 14-90  H-Bb S-Bb L-Bb 
3azk X-ray 3.2 C 11-90  H-Bb S-Bb L-Bb 
3azm X-ray 2.89 G 15-90  H-Bb S-Bb L-Bb 
3azm X-ray 2.89 C 13-90  H-Bb S-Bb L-Bb 
3ayw X-ray 2.9 G 16-90  H-Bb S-Bb L-Bb 
3ayw X-ray 2.9 C 11-90  H-Bb S-Bb L-Bb 
3azn X-ray 3 G 15-90  H-Bb S-Bb L-Bb 
3azn X-ray 3 C 11-90  H-Bb S-Bb L-Bb 
3a6n X-ray 2.7 G 15-90  H-Bb S-Bb L-Bb 
3a6n X-ray 2.7 C 14-90  H-Bb S-Bb L-Bb 
3an2 X-ray 3.6 G 15-90 None
3an2 X-ray 3.6 C 16-90 None
3azh X-ray 3.49 G 15-90  H-Bb S-Bb L-Bb 
3azh X-ray 3.49 C 13-90  H-Bb S-Bb L-Bb 
6ke9 X-ray 2.22 G 14-90 None
6ke9 X-ray 2.22 C 16-90 None
5cpi X-ray 2.9 G 15-90  H-Bb S-Bb L-Bb 
5cpi X-ray 2.9 C 11-90  H-Bb S-Bb L-Bb L-Mn 
4z5t X-ray 2.8 G 15-90  H-Bb S-Bb L-Bb 
4z5t X-ray 2.8 C 14-90  H-Bb S-Bb L-Bb 
6j4w X-ray 7.9 c 4-78 None
6j4w X-ray 7.9 g 1-77 None
4ym6 X-ray 3.51 G 15-90  H-Bb S-Bb L-Bb 
4ym6 X-ray 3.51 C 11-90  S-Bb L-Bb 
3w96 X-ray 3 G 16-90 None
3w96 X-ray 3 C 12-90 None
6hkt X-ray 9.7 M 14-88  H-Bb S-Bb 
6hkt X-ray 9.7 Q 16-92  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 w 16-92  H-Bb S-Bb S-Mn L-Bb 
6hkt X-ray 9.7 0 14-90  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 W 16-90  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 q 16-90  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 m 14-90  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 2 16-90  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 g 14-88  H-Bb S-Bb 
6hkt X-ray 9.7 c 16-92  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 G 14-90  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 C 16-90  H-Bb S-Bb L-Bb 
3w97 X-ray 3.2 G 16-90  H-Bb S-Bb L-Bb 
3w97 X-ray 3.2 C 13-90  H-Bb S-Bb L-Bb 
5xf3 X-ray 2.6 G 14-90 None
5xf3 X-ray 2.6 C 14-90 None
5b0y X-ray 2.56 G 15-90  H-Bb S-Bb L-Bb 
5b0y X-ray 2.56 C 14-90  H-Bb S-Bb L-Bb 
5av6 X-ray 2.2 G 14-90 None
5av6 X-ray 2.2 C 13-90 None
6jr0 X-ray 2.5 G 12-90  H-Bb S-Bb S-Mn L-Bb 
6jr0 X-ray 2.5 C 14-90  H-Bb S-Bb L-Bb 
5gse X-ray 3.14 M 12-90  H-Bb S-Bb L-Bb 
5gse X-ray 3.14 C 16-90  H-Bb S-Bb L-Bb 
5gtc X-ray 2.7 G 12-90  H-Bb S-Bb L-Bb 
5gtc X-ray 2.7 C 11-90  H-Bb S-Bb L-Bb 
6ipu X-ray 1.99 G 13-90 None
6ipu X-ray 1.99 C 13-90 None
6t7c X-ray 4 G 13-90  H-Bb S-Bb L-Bb 
6t7c X-ray 4 C 13-90  H-Bb S-Bb L-Bb 
5gxq X-ray 2.85 C 11-90  H-Bb S-Bb L-Bb 
5gxq X-ray 2.85 G 15-90  H-Bb S-Bb L-Bb 
5av8 X-ray 2.2 G 14-90 None
5av8 X-ray 2.2 C 13-90 None
5avb X-ray 2.4 G 14-90 None
5avb X-ray 2.4 C 13-90 None
5b2i X-ray 3 G 14-90 None
5b2i X-ray 3 C 13-90 None
5b32 X-ray 2.35 C 11-90  H-Bb S-Bb L-Bb 
5y0d X-ray 1.99 G 15-90  H-Bb S-Bb S-Mn L-Bb 
5y0d X-ray 1.99 C 11-90  H-Bb S-Bb S-Mn L-Bb L-Mn 
5avc X-ray 2.4 G 14-90 None
5avc X-ray 2.4 C 13-90 None
5xf5 X-ray 2.82 C 14-90 None
5xf5 X-ray 2.82 G 14-90 None
5b24 X-ray 3.6 G 15-90  H-Bb S-Bb L-Bb 
5b24 X-ray 3.6 C 11-90  H-Bb S-Bb L-Bb 
5b31 X-ray 2.2 C 13-90  H-Bb S-Bb L-Bb 
6m3v X-ray 4.6 Q 15-90  H-Bb S-Bb S-Mn L-Bb 
6m3v X-ray 4.6 M 16-90  H-Bb S-Bb L-Bb 
6m3v X-ray 4.6 G 16-90  H-Bb S-Bb L-Bb 
6m3v X-ray 4.6 C 16-90  H-Bb S-Bb L-Bb 
5jrg X-ray 2.5 C 12-90  H-Bb S-Bb S-Mn L-Bb 
3w99 X-ray 3 G 17-90  H-Bb S-Bb L-Bb 
3w99 X-ray 3 C 14-90  H-Bb S-Bb L-Bb 
3wkj X-ray 2.8 G 15-90  H-Bb S-Bb L-Bb 
3wkj X-ray 2.8 C 12-90  H-Bb S-Bb L-Bb 
5av5 X-ray 2.4 G 14-90 None
5av5 X-ray 2.4 C 13-90 None
5y0c X-ray 2.09 G 15-90  H-Bb S-Bb S-Mn L-Bb 
5y0c X-ray 2.09 C 11-90  H-Bb S-Bb S-Mn L-Bb L-Mn 
6kxv X-ray 3.63 G 15-90  H-Bb S-Bb L-Bb 
6kxv X-ray 3.63 C 11-90  H-Bb S-Bb L-Bb 
6l49 X-ray 18.9 Q 14-90 None
6l49 X-ray 18.9 Y 14-90 None
6l49 X-ray 18.9 U 16-90 None
6l49 X-ray 18.9 M 16-90 None
6l49 X-ray 18.9 G 15-90 None
6l49 X-ray 18.9 C 16-90 None
5zbx X-ray 2.58 G 15-90  H-Bb S-Bb L-Bb 
5zbx X-ray 2.58 C 11-90  H-Bb S-Bb L-Bb L-Mn 
5b2j X-ray 2.6 G 14-90 None
5b2j X-ray 2.6 C 13-90 None
6inq X-ray 6.9 g 14-90 None
6inq X-ray 6.9 c 4-78 None
6a5o X-ray 9.9 g 14-90 None
6a5o X-ray 9.9 c 4-78 None
6a5u X-ray 7.6 c 16-90 None
6a5u X-ray 7.6 g 1-77 None
6iq4 X-ray 2.25 G 14-90 None
6iq4 X-ray 2.25 C 14-90 None
6a5p X-ray 7 c 16-90 None
6a5p X-ray 7 g 1-77 None
6j4x X-ray 4.3 g 14-90 None
6j4x X-ray 4.3 c 4-78 None
6j51 X-ray 4.2 g 14-90 None
6j51 X-ray 4.2 c 4-78 None
6t7a X-ray 3.7 C 13-90  H-Bb S-Bb L-Bb 
6t7a X-ray 3.7 G 13-90  H-Bb S-Bb L-Bb 
5cpj X-ray 3.15 G 15-90 None
5cpj X-ray 3.15 C 14-90 None
6a5l X-ray 5.6 g 1-77 None
6a5l X-ray 5.6 c 16-90 None
6le9 X-ray 2.6 G 14-90 None
6le9 X-ray 2.6 C 16-90 None
7ccr X-ray 4.9 G 15-90 None
7ccr X-ray 4.9 C 16-90 None
7ccr X-ray 4.9 R 15-90 None
7ccr X-ray 4.9 N 16-90 None
4ym5 X-ray 4.01 G 16-90  H-Bb S-Bb L-Bb 
4ym5 X-ray 4.01 C 14-90  H-Bb S-Bb L-Bb 
5b0z X-ray 1.99 G 15-90  H-Bb S-Bb L-Bb 
5b0z X-ray 1.99 C 11-90  H-Bb S-Bb S-Mn L-Bb 
6j50 X-ray 4.7 g 1-77 None
6j50 X-ray 4.7 c 16-90 None
6l4a X-ray 12.3 Y 14-90 None
6l4a X-ray 12.3 U 16-90 None
6l4a X-ray 12.3 Q 14-90 None
6l4a X-ray 12.3 M 16-90 None
6l4a X-ray 12.3 G 14-90 None
6l4a X-ray 12.3 C 16-90 None
6jxd X-ray 2.25 G 13-90 None
6jxd X-ray 2.25 C 12-90 None
6r90 X-ray 4.5 G 16-91  H-Bb L-Bb 
6r90 X-ray 4.5 C 12-91  H-Bb S-Bb L-Bb 
6ir9 X-ray 3.8 g 14-90 None
6ir9 X-ray 3.8 c 4-78 None
5b40 X-ray 3.33 G 15-90 None
5b40 X-ray 3.33 C 14-90 None
6a5t X-ray 6.7 c 4-78 None
6a5t X-ray 6.7 g 14-90 None
6v92 X-ray 20 g 15-90  H-Bb S-Bb L-Bb 
6v92 X-ray 20 c 17-90  H-Bb S-Bb L-Bb 
6r93 X-ray 4 G 12-91  H-Bb S-Bb L-Bb L-Mn 
6r93 X-ray 4 C 12-91  H-Bb S-Bb L-Bb 
5ay8 X-ray 2.8 G 15-90  H-Bb S-Bb L-Bb 
5ay8 X-ray 2.8 C 14-90  H-Bb S-Bb L-Bb 
7ccq X-ray 3.8 G 15-90 None
7ccq X-ray 3.8 C 16-90 None
6la8 X-ray 3.4 Q 16-90  H-Bb S-Bb L-Bb 
6la8 X-ray 3.4 M 13-90  H-Bb S-Bb L-Bb 
6la8 X-ray 3.4 G 13-90  H-Bb S-Bb L-Bb 
6la9 X-ray 3.7 M 13-90  H-Bb S-Bb L-Bb 
6la9 X-ray 3.7 G 13-90  H-Bb S-Bb L-Bb 
6la9 X-ray 3.7 C 13-90  H-Bb S-Bb L-Bb 
6la9 X-ray 3.7 Q 15-90  H-Bb S-Bb L-Bb 
6usj X-ray 10.5 C 11-90 None
6usj X-ray 10.5 G 15-90 None
6usj X-ray 10.5 M 11-90 None
6usj X-ray 10.5 Q 15-90 None
6m44 X-ray 3.81 C 16-90  H-Bb S-Bb L-Bb 
6m44 X-ray 3.81 G 16-90  H-Bb S-Bb L-Bb 
6m44 X-ray 3.81 M 16-90  H-Bb S-Bb L-Bb 
6m44 X-ray 3.81 Q 13-90  H-Bb S-Bb L-Bb 
7c0m X-ray 3.9 C 16-90  H-Bb S-Bb L-Bb 
7c0m X-ray 3.9 G 14-90  H-Bb S-Bb L-Bb 
7c0m X-ray 3.9 c 16-90  H-Bb S-Bb L-Bb 
7c0m X-ray 3.9 g 14-90  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text