Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P04912
RecName: Histone H2A.2
Begin-End: 17-92
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb S-Bb S-Mn L-Bb 

Sequence:
QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNK
KTRIIPRHLQLAIRND
Structures of the domain P04912 17-92
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4jjn X-ray 3.09 G 16-89  H-Bb S-Bb S-Mn L-Bb 
4jjn X-ray 3.09 C 15-89  H-Bb S-Bb L-Bb 
4kud X-ray 3.2 C 16-89  H-Bb S-Bb L-Bb 
4kud X-ray 3.2 G 16-89  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text