Pfam domain
Pfam family: Exonuc_X-T_C (PF08411.9)
Uniprot AC: P04995
RecName: Exodeoxyribonuclease I
Begin-End: 212-473
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RNKHKLMALIDVPQMKPLVHVSGMFGAWRGNTSWVAPLAWHPENRNAVIMVDLAGDISPL
LELDSDTLRERLYTAKTDLGDNAAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCL
DNLKILRENPQVREKVVAIFAEAEPFTPSDNVDAQLYNGFFSDADRAAMKIVLETEPRNL
PALDITFVDKRIEKLLFNYRARNFPGTLDYAEQQRWLEHRRQVFTPEFLQGYADELQMLV
QQYADDKEKVALLKALWQYAEE
Structures of the domain P04995 212-473
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4js4 X-ray 3.1 B 212-472 None
4js4 X-ray 3.1 A 212-472 None
4js4 X-ray 3.1 B 212-472 None
4js4 X-ray 3.1 A 212-472 None
4jrp X-ray 1.95 A 212-472 None
4jrp X-ray 1.95 B 212-472 None
4jrp X-ray 1.95 B 212-472 None
4jrp X-ray 1.95 A 212-472 None
4js5 X-ray 3.5 A 212-472 None
4js5 X-ray 3.5 B 212-472 None
4jrq X-ray 3 B 212-472 None
4jrq X-ray 3 A 212-472 None
4jrq X-ray 3 B 212-472 None
4jrq X-ray 3 A 212-472 None
4hcb X-ray 2 B 212-472 None
4hcb X-ray 2 A 212-472 None
4hcc X-ray 2.96 B 212-472 None
4hcc X-ray 2.96 A 212-472 None


© NPIDB team 2003 - 2019

text